SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ017576-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ017576-PA
Domain Number 1 Region: 4-182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.68e-40
Family G proteins 0.0000272
Further Details:      
 
Domain Number 2 Region: 182-220
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000235
Family SOCS box-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ017576-PA
Sequence length 291
Comment (Culex quinquefasciatus)
Sequence
MAKEYDYLLKVLLVGDSDVGKQEILSGLDDGSAESPFCSGSAAYKTTTILLDGKRVKLQV
WDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGLSRWLKEVEEHAPGVPKVLVGNR
LHLAFKRQVAAKQAELYASRNKMACFEISPLCDFNIRESFCELARMALHRNGMERLWRSN
RVLPLQELCCRTIVRRTSVYAIDSLPLPPSVKSYLKSYALTSSQCLSSSHQAQALLAHNG
RPLAPLASNAKNLKCKTPTGSGSGQWHRSSGTGIGAGGGIGNNVRNSCVIS
Download sequence
Identical sequences B0XDP4
XP_001867766.1.94360 CPIJ017576|rab-40|protein_coding|supercont3.959|12647|14215 7176.CPIJ017576-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]