SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ018606-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ018606-PA
Domain Number 1 Region: 23-75
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000471
Family Tachycitin 0.051
Further Details:      
 
Domain Number 2 Region: 81-139
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000068
Family Tachycitin 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ018606-PA
Sequence length 142
Comment (Culex quinquefasciatus)
Sequence
MGYKVLLLPLALVLLSTATKAFFCDGIPPGLKIRHPIAAICNEYFACHHSQEHPWFCPRG
QFFSQRTQTCVATCDTSESLNPCIGMPNGQLVRPPLLQPNNCRQHYECISGMMVPRECEI
GTFFSQLNQGCGSVREPLCIPG
Download sequence
Identical sequences B0XHM6
XP_001869148.1.94360 CPIJ018606|conserved 7176.CPIJ018606-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]