SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7176.CPIJ018977-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7176.CPIJ018977-PA
Domain Number 1 Region: 10-41
Classification Level Classification E-value
Superfamily WW domain 0.00000000049
Family WW domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7176.CPIJ018977-PA
Sequence length 160
Comment (Culex quinquefasciatus)
Sequence
MAAAAKAESEWTEQRTKEGKLFYWNSVTKESVWEKPDGFQAEKQPATDKKVEKSSEPGQP
TPRSKPLNVMRIAADLEKHYSGVTEVTKLHRNKLRVALNNAKEANGIVCDPKFSVEYRVW
IPARSVEIDGVVSEDHLTVQQVLKGVGIFKRKNLQTVQVI
Download sequence
Identical sequences B0XHN1
CPIJ018977|conserved 7176.CPIJ018977-PA XP_001869153.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]