SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0113312 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0113312
Domain Number 1 Region: 40-93
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000314
Family Tachycitin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0113312
Sequence length 94
Comment (Drosophila ananassae)
Sequence
MWTKIIVILVVIHCLAALPAPEQDDAGSWSADEACKGLTTTTHIENQNDSTCKTFILCYV
TNSSTQAVTINCKSGMYFDSTLKICSTNKPENCT
Download sequence
Identical sequences B3M5T0
XP_001956814.1.52611 7217.FBpp0113312 FBpp0113312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]