SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0114349 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0114349
Domain Number 1 Region: 141-377
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-82
Family Calponin-homology domain, CH-domain 0.00000235
Further Details:      
 
Domain Number 2 Region: 3676-3853
Classification Level Classification E-value
Superfamily Plakin repeat 5.49e-27
Family Plakin repeat 0.0064
Further Details:      
 
Domain Number 3 Region: 6501-6660
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-27
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 4 Region: 7366-7525
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-26
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 5 Region: 3868-4008,4064-4101
Classification Level Classification E-value
Superfamily Plakin repeat 3.14e-26
Family Plakin repeat 0.0098
Further Details:      
 
Domain Number 6 Region: 7517-7638
Classification Level Classification E-value
Superfamily Spectrin repeat 8.04e-26
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 7 Region: 4268-4408
Classification Level Classification E-value
Superfamily Plakin repeat 3.14e-25
Family Plakin repeat 0.0081
Further Details:      
 
Domain Number 8 Region: 1551-1614,1678-1790
Classification Level Classification E-value
Superfamily Plakin repeat 7.85e-25
Family Plakin repeat 0.0045
Further Details:      
 
Domain Number 9 Region: 391-508
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-24
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 10 Region: 2003-2157,2211-2263
Classification Level Classification E-value
Superfamily Plakin repeat 5.76e-23
Family Plakin repeat 0.011
Further Details:      
 
Domain Number 11 Region: 6612-6767
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-22
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 12 Region: 4756-4950
Classification Level Classification E-value
Superfamily Plakin repeat 2.35e-22
Family Plakin repeat 0.002
Further Details:      
 
Domain Number 13 Region: 7274-7415
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-22
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 14 Region: 8453-8528
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.4e-22
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 15 Region: 4114-4259
Classification Level Classification E-value
Superfamily Plakin repeat 5.41e-22
Family Plakin repeat 0.0055
Further Details:      
 
Domain Number 16 Region: 2353-2421,2450-2533
Classification Level Classification E-value
Superfamily Plakin repeat 9.55e-22
Family Plakin repeat 0.0088
Further Details:      
 
Domain Number 17 Region: 6087-6220
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-21
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 18 Region: 7717-7855
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-21
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 19 Region: 7036-7191
Classification Level Classification E-value
Superfamily Spectrin repeat 3.89e-21
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 20 Region: 7920-8041
Classification Level Classification E-value
Superfamily Spectrin repeat 1.85e-20
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 21 Region: 5761-5899
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-20
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 22 Region: 1779-1936
Classification Level Classification E-value
Superfamily Plakin repeat 2.88e-20
Family Plakin repeat 0.0027
Further Details:      
 
Domain Number 23 Region: 4503-4606
Classification Level Classification E-value
Superfamily Plakin repeat 1.31e-18
Family Plakin repeat 0.0066
Further Details:      
 
Domain Number 24 Region: 2535-2670,2714-2733
Classification Level Classification E-value
Superfamily Plakin repeat 1.48e-18
Family Plakin repeat 0.0047
Further Details:      
 
Domain Number 25 Region: 798-919
Classification Level Classification E-value
Superfamily Spectrin repeat 4.65e-18
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 26 Region: 5268-5413
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-17
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 27 Region: 7629-7746
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-17
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 28 Region: 8071-8184
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-16
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 6729-6868
Classification Level Classification E-value
Superfamily Spectrin repeat 4.75e-16
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 30 Region: 709-843
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000125
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 31 Region: 7189-7309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000245
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 32 Region: 6926-7053
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000295
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 33 Region: 5468-5591
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000072
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 34 Region: 1278-1379,1413-1437
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000155
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 35 Region: 8362-8443
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000168
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 36 Region: 6014-6115
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000537
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 37 Region: 6280-6438
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000576
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 38 Region: 5869-5998
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000633
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 39 Region: 5023-5146
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000302
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 40 Region: 5656-5790
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000317
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 41 Region: 5155-5263
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000677
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 42 Region: 1206-1308
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000245
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 43 Region: 4949-5054
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000976
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 44 Region: 4641-4728
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000994
Family Plakin repeat 0.011
Further Details:      
 
Domain Number 45 Region: 2715-2801,2833-2860
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000144
Family Plakin repeat 0.021
Further Details:      
 
Domain Number 46 Region: 647-741
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000275
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 47 Region: 4417-4508
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000392
Family Plakin repeat 0.0063
Further Details:      
 
Domain Number 48 Region: 8177-8265,8317-8342
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000173
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 49 Region: 1047-1196
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000979
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 50 Region: 479-606
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000288
Family Spectrin repeat 0.0097
Further Details:      
 
Weak hits

Sequence:  7217.FBpp0114349
Domain Number - Region: 925-979
Classification Level Classification E-value
Superfamily SH3-domain 0.000285
Family SH3-domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0114349
Sequence length 8806
Comment (Drosophila ananassae)
Sequence
MTSHSYYKDRLGFDPNEQQNEHSHLHSSNSNSNSNSMKRSSSRQTTHHHQSYHHATTSSS
QSPARISVSPGGNPGNNGTLEYHQVQREQRDRELYSNNHHHSHHHQQQSHHHRHSSGNTS
SPLYESSPAAPKKAKHSSTQPQPQGGYEDALTQFKDERDAIQKKTFTKWVNKHLKKANRR
VVDLFEDLRDGHNLLSLLEVLSGEHLPREKGKMRFHMLQNAQMALDFLRYKKIKLVNIRA
EDIVDGNPKLTLGLIWTIILHFQISDIVVGKEDNVSAREALLRWARRSTARYPGVRVNDF
TSSWRDGLAFSALVHRNRPDLLDWRKARNDRPRDRLETAFHIVEKEYGVTRLLDPEDVDT
NEPDEKSLITYISSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQFIYWCREKTAYLQE
RSFPPTLIEMKRLLSDLQRFRSEEVSARKREKSKLIQIYKELERYFETVGEVDVEAELRP
DAIEKAWYRMNTALQDREVILQQEIERLERLQRLADKVQREIKHVDQKLTDLETRIVEEG
RRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPHVSELHKKVNKLHQR
WAQLRTNFHTNLVQKLSGLKYPVHETTVTRQTRMVVESRQIDTNPHFRDLQEHIEWCQNK
LKQLLAADYGSDLPSVKEELDRQQHEHKIIDQFHSKILNDERQQTKFSGDELALYQQRLN
QLQKVYAELLSTSTKRLSDLDSLQHFLGQASAELQWLNEKEQVEISRDWADKQLDLPSVH
RYYENLMSELEKREMHFATILDRGEALLNQQHPASKCIEAHLTALQQQWAWLLQLTLCLE
VHLKHATEYHQFFGEIKDAEQWLAKRDEILNSKFSQSDFGLDQGETLLRGMQDLREELNA
FGETVATLQRRAQTVVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEKGETVTLLDNSGRV
KWRVRTSKGQEGSIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQKKHLRLRQNMIFA
TIRVVKGWDFDQFLAMGPEQRTAIRRALNDDADKLLSEGDPNDPQLRRLRREMDEVNRLF
DEFEKRARAEEESKQASRIFTEECIAIKSKLEDMARELDQIILAPLPRDLDSLEHVLEIH
ADYERRLHLLEPELKHLQETFRTIALKTPVLKKSLDNLMELWKELNTQSGLHKDRLKLLE
ASLAGLEDNEHVISELENELAKHQDLPSTAEGLQQVFKQLTHMQDVITQQQPQMDKMNDA
ADQLGRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLAERMRSCETAIGLMKNLQSSVQ
VEESWVDGTTERLSAMPTATSAYELDKLLGAAIERKPKIENVNVAGGRLIREAKIYDSKC
LRFVDWLLEARPSFSPPRRDLRPADSDPGATQYYSQRLDNLNTKYDRLLEQLSQRLKTAI
EVNGSDGLQYAESLQKPLKTFRVDFSAGSVPTGDGYAARPEDLYTTTYSTTQFSSTKTTK
SSTKSVYSSDGLDAASQEVITSNLPPSQIQFNEIRTLKRSQQLGGNSVLDIAGIRDPRTG
RVLTIGEAIQLRILDVRTGEMLVGDRRISLEQAAEQGLIDAQLARQLLQPGAGRDASGRE
LSLLEVIQREINEAESGYETAEKRIKVNSTVTVESTGSPENPRNIADAITAGSVDTKTGL
YRVKSGQTISLAEAYERGYLIRHESVTIKSNALCLSDAIAHGLVDGAGWIADRNSGDKFR
LDSAIANQLIDAGVREVVDAKRDTKITLQEALQSGVLNAKTGRYVNEVTKEKLTFAEARN
RQLIVKPYTLKDICDLNLLDKQAQITSPMRREKLSIMQAIEAGVLDGNNLKCITKRKGEL
VTLQEAIADGIVLPAECKYRDFMTGELISIPEAVERGLISSVAQRSIFDIDGFKDLRSSD
YVSFNVALSRDLLRRKSTGFALETGRDSLVPLEVAVGEGLVRQEVYEMFNRGIGVQNASG
QELSVFDLVYHNLIDPKTGYLLDPKTGETVPLDTAIERKFITAEGALLLSSLLNITLTTE
TVTRTINRYVTIRAGSQEPGDQVLLTFTEAVRQGFIDEERQLFKDPKTGNIYSVQQALNY
GLLVPDSNQTVPEPTNRKKTKSTITIVTKQIIPEAEPIKLNTQHTKYVEKSVEIPISQEL
IKPQRVVSDFINMEKSSYIEQNVTERQIMELPPGGWRLKDAIEQRIFNPDTGVFHVQGTD
RLVNFEECINKQIINNLSVSIIDPSTGDKISVQSAFERDILDSYGNYTNSRKQVLGMRSA
IDEGKIILETVPATRGSSQKTILRITRVNNMPDVLEVSTPLKDAPPKFVEVSTCQRELAS
PEPLQIAPGAIYDPSTALVIFTQSGETENIFDAARQGLIDEQLIKIVDPRTKQPISVTEA
IARSIYDPKTETILDAEGQPVDLITATKLGLLSVVGAPLVAAEGALRTVRFVTDPRTGEQ
IPVEVAYERGIVSRDQLQRGRSFDSEPSTTTVEEKVVVLQRMRKIILKPKDALRKGIIDE
ETCKILEDTNNFTNPQGEVVNITEALNTGMIDGRRGKIIDPQSNRVLNLRQAVEQKILDP
EQTNHILMPLAKSLSVPRLAAQGLVDPKTQTIVHPESGYPLSIHEAIVCEVLDPHSTLRK
PEKCTLEAAIKKGIVDADESIFKYKNKNLNISEAIEARLFDPSYDQQKSKVDIPPVGMIF
PVAVEKSLVEPSKRVVLHPSTKNALPIKQAIDENFIMSIPYAPKKDAIEVVAAMERDLID
VAAQTITVPTTGERLPLRQAMENGVLVVKQLSDFVVTQKPIPKTEIMETVRAVHTVTTKT
IELMQGYVLISNNEVQNVNTGEVVSLEEAKELGILREESTTRETKAAAGESPEAVQNLPT
SSDQTVVVEERTQTVVVSSDTHKQEMQVISTTQSTKENPAIPTVSEAETKVGKEPSKTLQ
NVKDAAKMGALGVIAAPVLAGGALVSGVKSLIKSVKSPAEDAKTTTQKPEKPQSSFIEQE
RRNVPEPQQVPSEVDNLLNETENFISSTTANFIINEQQQEKPQEVSRQEVESTNTLTTTT
VTTITTSKTTTETGDAEPVVVEDVKTTTTVETTPVEPEIAKKPEDKPVDVQVTETITTVT
REETISEPEKPTTKEPTPEKIVEKKPVEKPAKKETTPAPVTKETTPAPVTKEPTPEPIQK
EKTPEPAPREAAQVPTKPEPQPRTAVKEEVPAFEPPFTAPLAPFEEPKAETKITEVTTEV
QEPVSSTETITTITTTVTTIDQQPKEVTEVDKSEPAKITEVEVEKPAVQEPIKDDKPSEI
LDEVSEEPTSSIVVEERVITVEEPTITESTVTTTITTTTTTTSSEEQQPQETVVTEIVKE
EPKKDTPQPEKTVVTEELVKEEPAKDASQPITEPTQTTETVTTTTTIIQEEKPQQPGDLE
QIVQPPTSTNKHQSVVDFIQAEKNTQPSEGSKVLQNVKDAAKLGALAIVGAPVLAGKALV
DALTSDKATKTGQPTTHVVTEIVEELPADISRTTSTIVTKVTTTTTTTTTTGEGSPEDEA
RDVVELPISSAEPTIKREVPKTLPIGDAISQKLISPDECQVIVDGEQQSQTVSTLLKEEQ
LSPLDEVQIIDDKLIILQQISYLVDVDTELTPEKLSELNIYDPENQYFIDPTTGQKISFQ
TLVFDMNIFNPETILVKNFSTGKYETLTAALERPLLDRHTGHMVDPKTGKKIPFFECIER
QWIIRADPEEQKPTGMENVTIDPQTGQVILDDGRVCSIVEAINSGKLDIQSISVRDPVSG
EVIPLRMAIELGVVDMQAGTVIDIQTLKEIPMELAFQLGFLVPGARKPISLEAAVRKGLY
DPETGKLFDSESQNQVDVQKSIEIGLVDPKISLIVDTVTKKEVKLDCAIEDELVVPSTGQ
IKDNKNNTLVPFDVGVQQRLVKTDSVTWSLPEVLQREYYTPSTGKVLNPVTGEEILLQQA
IEMGFVELDTTLVKDADHDKIVPGKEAAKVGLLDTVRGTLSSPNISLDEAFVKGYLISTK
KPLSLVDCLLRGLYDPSTAKFTIDDKQLDLKSAIAQKLINPEELVLLDPKTESIISLTEA
IAKGYLDPIGGYVINPYTSTKLSLHEALENRILIPPKRKRSLPDAVYRGLYDPKTGQFSN
TVTREKLTTERAIRRGILDPDSTVVNVGSGQIIPFGVATETGIVDSRQGTVKDQDDKSID
FKEAFDRGVLVEAKKPLRLIEAVVKNVYDEVDGHFVDPKSGEKLNFAEALNTNLLDEHSV
QIRDFKTGLYKQLNLTHAKDSGVIDAQNSKLLYNNQTMTLKHAFDIGILMDVNAPISIQR
AIHQGLFDDKTGKLSDPRSGRQITLLEGMRSFVINPHLSCYFDEQTETMYSLSETCRNGI
INRREGVFREPGSSSFVPLGEALSLGLIVDIENAGFGLYELLSMGFYDTPTRKVLHPVTN
RKLNLNEACVEDVVSLSSSLVKHHETGKYLRLANAIKEQLIDDNRGCYNLGNEQLDLQAA
RARGFIVSNRRLLSLELVLRQQLYRPETGKFCDPTTGEYLDLIEAIHSGFIDPATTVFKN
QLTGKELPLGEAIENGDIDVSKGRVFDPKSKSAYNYDVALARGILVTVARPLTDRSEVVR
RQDSVELLGQTPVSVVISKPREMSLEEAIRYNIIDPKTALVRDFDSFKFLPYSVAVERGL
VDTTKRTLVDPKALYFAFDPTLIVYVREPITFDQAAESKCLDLQTGILTYVPVSSATGNE
SAPAGDDSANDSLTVIETPKVYTLKEAASAGVVDPDSALVKDLAKAKLVRLPEAFRKGLM
DANKANVLNTQTSKLCTLQEAYESGLICTPKRSFGLLEAITFNLYNPTNGCLVDPFQMHP
DIIRRRKFTLAEAIGSGLVDPSSTVVRDPSSGVIVPLTAAIGSGLIDAAEGRLTDASDPK
NNIDLVKAAEKGLLLPAEQRQAVFEKFNMCEENVNDLLKWVTTVEQKISSVGGPREKIDE
LRNQINALKQIKDEIESQQRPVATCLEQIRQIVLTGGDVLSAPEVTTLENSGRELRSRVD
RVNDRTVRLLRRLEAGRDELTKLRSELDVFSDWLQVARRTLEDKERSLSDLTRLPSQADS
VREFVSDVIGHQADLRFITMAAQKFVDESKEFLAILNDFRTSLPERLPHVEPLSSAESPI
RQEVSLVSAQYKDLLNRVNALQDRVSGLGGRQREYQDALDKANEWLRSIAPRVSRIIAEP
IAGDPKGVQDQMNEAKALHNELLSSGRLVDNAQQALDNLLRSLGGQLSPMEINQLELPIA
DLKNNYQQLLDNLGEHCKNLDKTLVQSQGVQDALDSLVGWVNQAEDKFKLNLRPASLIKE
RLQEQIREHKVLLADLQSHQASIDSVQISAKHLLASASNARIAKKVESNLNDVTGKFEKL
YEKANKRGEFLDDVYNRLGRYLDDISNVEQRMASLQEALDSRETSLLSTEELARRMNDLS
REKDHLAPQFEDCVRNGKDLIGLRDVTDTGVLRDRIKALESQWRNINISIDERAKLSKQK
AEQQLAYEGLKDQVLSWLASTEARVNGLPPVAIDLDRIKQQHDELKPICKDYRDYAPTID
KINDIGAQYDALIRPESPARKRSTYSPIKRASPLRRMSGDARSPSPTKGGILSPLSTGSS
GFGSRRSSQDGFQLSELSPVQQQLSEINNRYGLIGVRLNDRQHELDNLSEELRKQYDNLK
GLAQFLERIQRQVPKESVSNKDEAERCIKQARKILEDMYEKQSLLDTTKAQIKDILRRKS
DVPGAEQLRLENENIQEKWKNLNDICKNRIAFSEKLRDFLDTHGNLKSWLDSKERMLTVL
GPISSDPRMVQSQVQQVQVLREEFRTQQPQLKHFQELGHDVVDHLAGTPDAQAVEVKLKD
ILGKWEDLVGKLDDRANSLGGAADSSKEFDAAVNRLREALQNISDNLDALPTDGDHQENL
RKIENLERQLEGQRPLLADVEQSAATLCNILGDPASRADVNSRVAALEKQYLALQKKLDT
KKAETEASLRDGRHFAENCSKTLGWLGGELSNLTDRLLVSAHKPTLQHQIDTHEPIYREV
MAREHEVIMLINKGKDLSDRQQDRGVKRDLDRIQQQWEKLRREAVDRHTRLQTCMEHCKK
YSQTSEQFLAWLRTAEDKLSDLTPGVLSKAKLETRLRDLQTFRSEVWKHSGEFENTKGLG
ETFLTSCDIDKEPIKAELQDIRDRWERLNNDLIARAHEIENCSRRLGDFNDELRNLDHSL
GRCEDRLAAHDALGGAAKDPKLLERVKAIREELTNLSKPLQSLKALAKDISAEARAAGGD
ADHLTSEVDGLADRMSELQGRLDDRCGELQSAATAVSQFNEQMKSLGIDLNDLETEIEKL
SPPAREIKIVQQQLDDVGKIQHKLDRLVGRLEDAERAADVLVDAGFAADTTQTREQISTL
RKTLGRLDNRVRDHEDNLQATLKALREFYDNQSTTLDDIQDVSEEFKRMKPVGSELDQIR
RQQEDFRNFRERKVEPLAVNVDKVNVAGRDLVRSAGSGVSTTAIEKDLEKLNDRWNDLKE
RMNERDRRLDVALLQSGKFQEALAGLSKWLSDTEEMVANQKPPSSDYKVVKAQLQEQKFL
KKMLLDRQNSMGSLANLGKEVANHCEPAERASIEKQLNDLMKRFDALTDGAEQRELDLEE
AMEVAKRFHDKISPLELWLDNTERAVKSMELIPTDEEKIQQRIREHDRLHDEILGKKPDF
TDLADVAAQLMHLVSDEEAVNLGEKVRGVTERYTGLVDASDNIGALLSESRQGLRHLVLS
YQDLVAWMESMEAELKRFKSVPVYAEKLLEQMDHLLELNENIAGHASNVESTVESGAELM
KHISNDEAIQLKDKLDSLQRRYGDLTNRGGDLLKSAQNALPLVQQFHEAHNRLVEWMQSA
EAALAPSEPRQSDVLRLEGELADMRPILDTINLIGPQLCQLSPGEGAATIESIVTRDNRR
FDSIVEQIQRKAERLHLSNQRAKEVTGDIDELLEWFREMDTTLREADPPAMEPKLVRAQL
QEHRSINDDISSQKGRVRDVTAASKKVLRESPQSENTATLREKLDDLKEIVDTVAQLCSE
RLGILEQALPLSEHFADSHQGLTAWLDDMEQQISRLSMPALRPDQITLQQDKNERLLQSI
AEHKPLLDKLNKTGEALGALVADEDSAKINEILDTDNARYAALRLELRERQQALESALQE
SSQFSDKLEGMLRALANTVDQVNQLDPLSALPQKIREQIEDNDALMDDLDKRQDAFSAVQ
RAANDVIAKAGNKSDPAVRDIKAKLEKLNNLWNDVQNATKKRGSSLDDILSVAEPFWKQL
NSVMKTLKDLEETLSCQEPPAAQPQDIKKQQVALQEIRHEIDQTKPEVEQVRRHGSNLMN
MCGEPDKPEVKKHIEDLDNAWDNITALYAKREENLIDAMEKAMEFHETLQNLLKFLTKAE
DKFAHLGAVGSDIDAVKRQIEQLKSFKDEVDPHMVEVEALNRQAVELTERTSPEQAASIR
EPLSVVNRRWEALLRGMVERQKQLEHALLHLGQFQHALNELLVWINKTDGTLDQLKPIPG
DPQLLEVELAKLKVLANDIQAHQNSVDTLNDAGRQLIETEKGSLEASTTQEKLRKLNNEW
KQLLQKASDRQHELEEALREAHGYIAEVQDILGWLGDVDAVIGASKPVGGLPETATEQLE
RFMEVYNELEENRPKVETIQAQGQEYIKRQNQMKVSSSNLQHTLRTLKQRWDAVVSRASD
KKIKLEIALKEATEFHDTLQAFVEWLTQAEKLLSNAEPVSRVLETIQAQMEEHKVLQKDV
STHREAMLLLDKKGTHLKYFSQKQDVILIKNLLVSVQHRWERVVSKAAERTRALDHGYKE
AREFNDAWSGMMQYLQETEQVLDQIIEEATASKEPQKIKKYIGKLKETHRQLGAKQSVYD
GTMRTGKNLMERAPKGDRPVLDKMLLELKEQWTRVWSKSIERQRKLEEALLLSGQFSDAL
GELLDWLKKAKSRLNENGPVHGDLETVQGLCEHHKHIEQDLQKRAAQMQGVLKTGRDLER
SGNNPEVGRQLDEMQSIWEEVKNAVAKRGDRLQVALVDAEKLNARVQALFDWLDHAEHKL
RYAKNAPDDEKVSREMMDIHMEFMKDLRVREREKTETFEYAEDIIGKAYPDAIPIIKNWL
SIIQQRWEEVRQWAINRESKLEQHLQSLKDLDDTIEELLAWLSGLEGTLLNLKHERLPDE
IPPVEKLIEDHKEFMENTARRQNEVDRACKPRQLPPGARKPSRSGKTPVFKGSRDQGLNA
RKGSRVTPTRDTPDRDRLPHYGPRFSPSTAGPELEFRSPRAKLLWTKWRDVWMLSWERQR
LLYDHLLYLKDVERARNFSWDDWRKRFLKYMNHKKSRLTDLFRKMDKDNNGMIPRDVFID
GILNTKFDTSGLEMKAVADLFDRNGEGLIDWQEFIAALRPDWQERKPATDSDKIHDEVKR
LVMLCTCRQKFRVFQVGEGKYRFGDSQKLRLVRILRSTVMVRVGGGWVALDEFLQKNDPC
RAKGRTNIELREQFILADGVSQSMAAFTPRRSTPNAAATASSSPNAQNGGSSNLPPYMSG
QGPIIKVRERSVRSIPMSRPSRSSLSASTPDSLSDNEGSHGGPSGRYTPRKVTYTSTRTG
LTPGGSRAGSKPNSRPLSRQGSKPPSRQGSTLSLDSTDDHTPSRIPQRKPSTASTTSGTT
PRPARLSVTSTTPGSRLNGTSTITRKTASGSASPAPTSNGGMSRSSSIPALTGFGFKPIR
RNISGSSTPSGMQTPRKSSAEPTFSSTMRRTSRGTTPTEKREPFRL
Download sequence
Identical sequences B3MHF6
FBpp0114349 7217.FBpp0114349 XP_001961134.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]