SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0116937 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0116937
Domain Number 1 Region: 8-123
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-39
Family Calponin-homology domain, CH-domain 0.00000721
Further Details:      
 
Domain Number 2 Region: 161-221
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.000000523
Family EB1 dimerisation domain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0116937
Sequence length 240
Comment (Drosophila ananassae)
Sequence
MTDLKLTVALTSVNGENMSRHDMLQWVNDIVQGQFKKIEELCSGSAYCQMMEMIFPNCIN
LKRVKMGAKLEHEYLHNLKLFQGAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDS
QAPGLENIKALANAPVAKPIKPREPKTPEQDPEDDNNKALKELMEERQTMNLKSDRMVEE
RDQCYNKLRLIEDLLDDMINNNQEVEFCKRVQVVLYKTIDGQNQEEVGESKEEDPNEGMY
Download sequence
Identical sequences FBpp0116937 7217.FBpp0116937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]