SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0117428 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0117428
Domain Number 1 Region: 100-268
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.98e-44
Family CRAL/TRIO domain 0.0000486
Further Details:      
 
Domain Number 2 Region: 22-96
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 5.62e-16
Family CRAL/TRIO N-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0117428
Sequence length 290
Comment (Drosophila ananassae)
Sequence
MPAIEHKLNVTEEEVPEHIRRLAKEQGECQSSKGQTIEQFRSYIIERNECQPHRNDDKYL
EKFLRARYWKIENSYKLLCSYYKFREHNKSYYEKVRPLDLRHVGESDILTVTPYRDQHGH
RILIYRFGLWRPNRVTVDDIFRATIILQELGSLEPISQIVGGVGIFDLKDLGFEHLLHLS
PSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMSSL
HNHINPEHLPKRYGGLHEDYSYTLWLDMLKEQCSSNNVQKDMEQLGFIFD
Download sequence
Identical sequences A0A0P8XGC8
7217.FBpp0117428 XP_014761512.1.52611 FBpp0117428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]