SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0117495 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0117495
Domain Number 1 Region: 88-156
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000178
Family Tachycitin 0.018
Further Details:      
 
Domain Number 2 Region: 173-223
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000131
Family Tachycitin 0.027
Further Details:      
 
Domain Number 3 Region: 26-80
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000706
Family Tachycitin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0117495
Sequence length 242
Comment (Drosophila ananassae)
Sequence
MAKIYISALLCLAMFGSMAAAAAGGCREANGTAPVSGSCDAYIECKNGVAEEKLCPDGLL
YNEKSTGYPCGYPIDVECNQASARLQAAQPTEDCPHQFGYYRMGDASHCGQFMNCAAGRG
FVFDCPEGLAWNPATYKCDWPDQVEDCDAEAFLGFSCPAPAPKSELLGEQEADYTFHPSQ
DNCQVYFICIEGRPRRIGCGEDQAFNQELKQCDDIDNVPNCSSAIREKGAQIKAARLHAK
KN
Download sequence
Identical sequences B3MMM2
FBpp0117495 7217.FBpp0117495 XP_001962692.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]