SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0119186 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0119186
Domain Number 1 Region: 201-402
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-49
Family DBL homology domain (DH-domain) 0.0000113
Further Details:      
 
Domain Number 2 Region: 7-141
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-28
Family Calponin-homology domain, CH-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 393-568
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-25
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 4 Region: 606-717
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-19
Family SH2 domain 0.0011
Further Details:      
 
Domain Number 5 Region: 711-779
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000341
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0119186
Sequence length 783
Comment (Drosophila ananassae)
Sequence
MIPGGVNADLWRECVAWLVRCKVIPPDHKAAQADAEIRILAMTLRDGVLLCNLVIHLDPS
SMDPREFNRKPQMAQFLCSKNIKLFLDVCHNNFGIRDADLFEPTMLYDLTNFHRVLITLA
KLSQCRKVQQMHPELIGFNLQLSPSERSHSDEAIYKDLHSTTTDNIACNGTGYDHTNTKE
EEVYQDLCALHRTSRSQTASTTSFEQRDYVIRELIDTESNYLDVLNALKTKFMLPLERHL
NQDELKAIFPRIRELADIHTNFLHKLRESLTPNAKIKMAQVFMEFREPFLIYGEYCSCLL
GAIDNLADVCKKNQIIDQLVQKCERDYNVGKLQLRDILSVPMQRILKYHLLLDKLVKETS
PGHEDYRSLERAKDAMIDVSQYINEVKRDSDHLVIIQKVKDSIFDLHQLQNGAGSDLLQY
GRLLLDGELHMKAHEDQKTKLRYAFVFDKILIMVKALHIRTGDMQYTYKDSHNLADYRVE
QSHSRRTLGRDTRFKYQLLLARKSGKTAFTLYLKSEHERDKWRKALTEAMESLEPPGCRS
TDHKMEIYTFDAPTTCRHCSKFLKGRIHQGYRCKVCQISVHKGCISSTGRCKQNPVSMPP
PVCDRQLSEFNWFAGNMDRETAANRLENRRIGTYLLRVRPQGPSTAHETMYALSLKTDDH
VIKHMKINQENAGESMLYCLSSRRHFKTIVELVSYYERNDLGENFAGLNQSLQWPYKEVI
ATALYDYEPKAGSNQLQLRTDCQVLVIGKDGDSKGWWRGKIGDTVGYFPKEYVQEQKTAS
EEL
Download sequence
Identical sequences FBpp0119186 7217.FBpp0119186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]