SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0119857 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0119857
Domain Number 1 Region: 24-100
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.0000051
Family GIY-YIG endonuclease 0.012
Further Details:      
 
Weak hits

Sequence:  7217.FBpp0119857
Domain Number - Region: 195-261
Classification Level Classification E-value
Superfamily RING/U-box 0.0161
Family RING finger domain, C3HC4 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0119857
Sequence length 299
Comment (Drosophila ananassae)
Sequence
MSFRKFTATADPEKDETIARKGHFYGVYLLCSQSLDSRYRGKCYVGFTVNPKRRIKQHNR
GCDFGGAKKTSRKGPWQMVMIVHGFPNNIVALQFEWAWQQPTLSTRLKIFPELKRKNPRE
SHFDYNFRILNRMLGVGPWNRLALKIRWLETDYERGFEVPLPRHMEIVSGKVSISSSQRR
KGEDAAATVPVAWAPECHLCMQRIDQPERSRLGCTNPTCRLTCHMLCLANYLLGDEPGHY
IPVGGECPLCETRLSWSALLQRKRLLNGIPEELLDQEEADEDLSDGPDVDSDVEVLESD
Download sequence
Identical sequences B3M0F3
FBpp0119857 7217.FBpp0119857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]