SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0120298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0120298
Domain Number 1 Region: 88-183
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-29
Family PDZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 8-64
Classification Level Classification E-value
Superfamily L27 domain 1.59e-21
Family L27 domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0120298
Sequence length 195
Comment (Drosophila ananassae)
Sequence
MADNAEPLTLARDVKRSIELLEKLQASGDFPTTKLAALQKVLNSDFMTSVREVYEHVYET
VDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
RIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAIGSVKLVVRYTPKVLEE
MEMRFDKQRNTRRRQ
Download sequence
Identical sequences B3M1Y3
XP_001953682.1.52611 XP_017103358.1.53830 FBpp0120298 7217.FBpp0120298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]