SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0120333 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0120333
Domain Number 1 Region: 420-662
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-31
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 
Domain Number 2 Region: 121-274,412-496
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.04e-19
Family HI0933 N-terminal domain-like 0.097
Further Details:      
 
Domain Number 3 Region: 1068-1098
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000491
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  7217.FBpp0120333
Domain Number - Region: 1099-1130
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000314
Family LIM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0120333
Sequence length 4754
Comment (Drosophila ananassae)
Sequence
MSRQHQRHHHHHHQQLHQPQQQQQLTAQQQQQQQLLMAEHAAAAEAAELFDLLCVATTMR
QILALHRAMCEAVGLRPSPLNDFYPRLKAKVRSWKAQALWKKFDARAAHRVYGKGAACSG
TRVLVIGAGPCGLRTAIEAQLLGAKVVVLEKRDRITRNNVLHLWPFVITDLRNLGAKKFY
GKFCAGSIDHISIRQLQCMLLKVALLLGVEIHEGVSFEHAVEPNGEGGGWRAAVSPSDHA
VSHYEFDVLIGADGKRNMLDFRRKEFRGKLAIAITANFINKKTEAEAKVEEISGVAFIFN
QAFFKELYGKTGIDLENIVYYKDETHYFVMTAKKHSLIDKGVIIEDMADPGELLAPANVD
TQKLHDYAREAAEFSTEYQMPNLEFAVNHYGKPDVAMFDFTSMFAAEMSCRVIVRKGCRL
LQCLVGDSLLEPFWPTGSGCARGFLSSMDAAYAIKLWSNPQNSTLGVLAQRESIYRLLNQ
TTPDTLQRDISAYTVDPATRYPNLNRDSVNSWQVKHLVDTDDPSILEQTFMDTHALQAPH
VDTPGRRKRRSGDTLPQGATLLRWISAQLHSHNFAAELKEPSDVFRNGRVLCALISRYRP
DLIDLAATKDMSPLECNELAFAVLDRELHINRIMTAKQSLDLTDVESRVWLAYLDQICEL
FRGEIPHIKHPKMDFSDLRQKYRINHAHAQPDFSKLLATKPKAKSPMQDAVDVPTTVQRR
SVLEEERAKRQRRHEQLMQSGGVAAGSGGGGVAGSGGATGAGSSLQPGQNDTPRRSKKRR
QTDKTANIEERQQRLQEIEENRQERMSKRRQQRYHQTQNFYKSLQLLQAGKLLREGGLGE
GGVAEDGTPFEDYSIFLYRQQAPVFNDRVKDLERKLLFPDRERGDIPSAMPRTADEQFSD
RIRNMEQRMTGRGGHGADKKPKDLMRAIGKIDSNDWNVREIEKKIELSKKTEIHGPKGRE
KVPKWSKEQFQARQHKMSKPQRQDSREAEKFKDIDQTIRNLDKQLKEGHNLDVGERGRNK
VASIAGQFGKKDEANSDEKNASSNATTNTNTVIPKSSSKVALAFKKQAASEKCRFCKQTV
YLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHFRLPPKPLPQRT
NKARKSAGAQPASPAAPSAPQAAAAAAALAAEPMDTTPPRDTVDLLETSRASAAAASADA
MSDDEANVIDEHEWSGRNFLPESNNDSQSELSSSDETDTESDSEMYEEADDSPFGVQTLQ
LASDWIGKQYAEDSDDSDDFYDSSEGIADDGKDDTEGEEFKKARELRREEVRLQPLPANL
PTDTETEKLTLNVDNKENLADRGSLKSANSFESARSQPATPLTPTPTRVEMEQLERNAPR
KFSSEIEAISEKLYHMNNMVKMNKDLEVLAKENLVKSDILRKLTLKEKWLAENAAIAAAQ
KSASVVAAPTTAAPPLQPKSKFDEKYEKVVSPPPQSVAEPKPKPVIDFNLDELKPRKPNF
EERPKEQLPKPPSLKNSKESKANVSRSNSLKSNASSGSPKVKKAPIPIENKMQIEGILST
MKKLQRQHSSDQDEDMDVDIEADVDMQPNKQLNTKLKEIQASSFAGTMDHIKSQLTMPTV
SAQAAPTVDLSKYFPNQKQEKSTSSNTNKNQKTLKDVDLAKYFPSSPAPQRRTVETVADR
LKKSQTEASLAKSKPQEEPPKPPERSKPKPSEESKAKPEEKVEQPKKEPAGKVDSKPVPP
KRQASLQTFSLRDHQMDGALDLTKKKNPVKVTTIVKKVPAKSGSATTVTKTTATATGKGK
TIKIIKKIVPKGTKAKKQAAAEAEAATKVAEEVPPPPTSPPPPKDETECILDEILGDGAT
RSPSSEYQRLFQDEKSPSDLSDNIDRILEETGLDLELGLPRRSSKKLVKTKSLGEGDFEL
KSSKPRLTGVQNILKRFESMSSVNSQNSQNSDEQAAFKLRRMESTTSNLSSLTRSRESIV
SASDSMSDLEKTMDYLRNEWRNEATNFLQKKRDKFYAQKEEQEKKEAEARSKPDPLRDLP
VQYRDSKLAKFFGMGGSRKSPEKRKSPIKKKKSPTKTTKTVTKVNNSLEELAKISNARQA
KQAQKKATKAVEKDSKPKPKPKPEIVKPAIPVPDDFEVLDLIKKATEAKELERSKTKSPA
VEEVLKEIAQEAKKELPTEEELPPPVVEDIRNLPKTGCDKSSLNSSRRGSQSSLVMSRRQ
SEISLNEKLNQEALVALTNLEKEREAEQVDELFQNMVDEMEQEQDHHSDPIAVAEPLEDD
VDADSLCTTISKSPSAQPVTVVKRGSSEDQSIEKLFGNFSDEMLVNVEFDSNDEVVGITP
RASLVNSKSEDRDYLGKLESLERDEDALQPLSGLEKFQQDNGQYEVDGLHFPSRPQRRPK
SSSSSSEPSLPKAPQRLRKKLAKLDPEDMAPSVQDLLNQVYTKNLQPQDLEVVPIEGGKT
LKFPSLVVEDDVAVDVVDHPEENVKENGVQKEELPPTPEKPSSTLASKNSSGSSLVDPVP
KIITPPKIRSKENSLDWDMEKLPASPMPRRKLPQPVVSKESSLEWNMEKLPNSPMPPRRN
KMRPISPSSNSVQLLNNLSSDDEATTQRRLIEDFERERRQALIKRDENFEASAAEQRRRD
SLQSSSNSSNSKRSLPPPTPPMLPSVSRRGTTQDTKPRHEGTPPMFKKLDVDGSGSASAS
ASATPWDSTACSTRRSSFAFIELQDNKPVIVPMPKKLKLPKVEAPRFVPEPVAADEPVPE
VFQGRSWPKSQAEMDADTEQDDEDPAEKLKKQLPEYARSDSPPSAAFKNRKWPDGKTVFD
QRAESMEEEDILGGLLASKRRGSNRIKEKPRSQSPPPFKPLVNSSRQSSKSYGDLKKGPS
LQSLSAQSSQDTDTLSTTTTVATTRPLSYAATYDDPMDASTKALLDRGKRLHNRKRDFVN
ERVVERNPYMREVLRSTDRREYDDVDEDLTSYRPRSYGSSTLSRFPSTSTRKSNAYDYLS
PSSDYLTRRSTGYSSIPAIGGSSSYYPSSVPATTTRSSHLSDLFRRRSPASGSSYGSSKD
SCVQTESESTSPDEVELNSATEISTDSEFDNDEIIRQAPKIFIDDTHLKKPTKVQIKSTM
IGQNAAAAAGLHQKQLAAREKGGSYLQKYQPQPPLPQFKPLVQVDPTLLIGTQRAPLQNP
RPGDYLLNKTASTEGIASKKSLELKKRYLLGEPANGNKIQKSGSTSVLDSRIRSFQSNIS
ECQKLLNPSSDISAGMRSFLDRTKLGEGQSQSQSNELMRSATSNVINDLRVELRIQKAPS
SHSTDNEKENVFVNCKNELNKGMEYTDAVNATLLDQLSKTKSNSPTTPTNNKTTVIEVID
LVTPEKLPIIDLTVVETPKKLDDTMDVDDRLTPDSNKITDLQQKEVKEEPKPDVSRDVKE
CIPDILGHIKEGAVVKEQDSEDQQSLLCQSDEEKRDSPEKEMAEQEPDSVQIQVPNIPWS
KPKPEAMSTTGSSGSSCTTTDSSSIEDIQHYILESTTSPDTQTAGGKHNVPRLEVHDTSG
TLMQVDSLMIVNGKYIGDPEDVKYLDMPADVIVPATPALKTSELELEDETEPVTATPEPA
DCTVIEAERQVEMRPPPLPEMGPPKLKFDSKNENKIESLKNLPLIVERNVEHSEAVKPIT
LNLSSVARTPDTPTTPTAHDSDKTPTGEVLSRGSDSETEATGTGQVLTETELSDWTADDC
ISENFVDMEFVLNSNKGTMKRRKERRRSGVNTKLPSGNEVIHEVARQAPVVDMDGILNAI
DIDDIEFMDTGSEGSCAEAYSATNTALLKNRGYMEYIETEPKKTPLRTAAAPVSYPGNLP
ALVTKRDEKLGIDYIEQGAYIMHDDAKTPVNEVPPAMTQSLTDSSTLNDLDDDSMAGMGL
SQTQQTTTEESEALTVVTSPLDTSSPRVLDQFASMLAAGKHDSQTPSSSEQQPKTSSAVT
TSSSGAPNSSPGNAAKEAVPPEDPDLQIQFEYVRALQQRISQISTQRRKSSKGEANAPVI
EAMEDQSKPKEESLPSSMRPRSSSSSSKVPEIPTLSSKLEEITKERTKQKDLIHDLVMDK
LQSKKALNAEKRLHRSRQRSLLTSGYASGSSLSPTPKLAAASSPQDSNCSSQAHYHASTA
EEPRPKPAERVLQKSATSTYVSPYRTVQAPTRSADLYKPRPFSEHIDGSVLDGYKLGKTS
SFNGGKLGDFATPIAPVRVNRGGGGGGNGASTIQDIGNISASTENLRSEARARARLKSNT
ELGLSPEEKMQLLRTRLHYDQNRGLKSKQLEEMPGQGELAARARKMSASKSVNDLAYLVG
HQQQQQQQLDMDAVLKAKAADFISDPNLAASGQEKAAKTKSGRRQKDPERRKSLIQSLSS
FFQKGTSATSTSAKDQGIPAVGGHSEPSERPGTSSSGTPTISEGAGGSGGGGGGVFSRFR
ISPKSKEKSKSCFDLRSFGFGDKDVLNCNATTATGAAATSQTKHSQEYLNNSRYRKQTNT
AKNSKPESFSSSSPQLYIHKPHHHHHNHHHLTAANPSALEDQIPPPIPPLPLNYQRSDDE
SYANETREHKKQRAISKASRQAELKRLRIAQEIQREQEEIEVQLKDLEARGVLIEKALRG
EAHNIENLDTNKDNDEKLLKELLEIWRNITALKKRDEELAIRQQELQLEYRHAQLKEELN
LRLSCNKLDKSSADVAAEGAILNEMLEIVAKRAALRPTASQLDLTSAGAASTSAEATTSI
KLTGQPHDHEESNI
Download sequence
Identical sequences FBpp0120333 7217.FBpp0120333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]