SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0122048 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0122048
Domain Number 1 Region: 4-82
Classification Level Classification E-value
Superfamily HMG-box 5.37e-18
Family HMG-box 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0122048
Sequence length 209
Comment (Drosophila ananassae)
Sequence
MASPNGPPKKPMGSFMIWMSTCGRKKIKAEHPDYKVTEVASLGGKIWHQMSNEDKFVWKK
KAALARSDYSSQLQLYVAKNPRLKASGAIYKRGRARPLPKVSIRRNSMSEPAIAGHSSTV
IESAYCHSKEETFSSQFQVSLENNPQMKASLTFYKRERTRPQPKVSRTRYSMSEPAIAGR
SSTVIENDHFHFKEETCSSSGYCSFECKF
Download sequence
Identical sequences B3LZZ3
7217.FBpp0122048 FBpp0122048 XP_001955622.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]