SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0123171 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0123171
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000314
Family Insect pheromone/odorant-binding proteins 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0123171
Sequence length 105
Comment (Drosophila ananassae)
Sequence
MQFTICFAAEDCLKVYNLTSKKVESVPPSTPVSEVPHNIKCYSRCIIDEYFGDDDKIDLK
RLENRARDDEKVILADCKQKYDDDSSDRCDYAYKIIQCLYLGRVN
Download sequence
Identical sequences 7217.FBpp0123171 FBpp0123171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]