SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0125461 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0125461
Domain Number 1 Region: 253-327
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.54e-26
Family GAS2 domain 0.00015
Further Details:      
 
Domain Number 2 Region: 12-63,95-174
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.01e-25
Family Calponin-homology domain, CH-domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0125461
Sequence length 973
Comment (Drosophila ananassae)
Sequence
MAMLEARPYRPFKSSEEYLEAMKEDLAEWLSTLYPELSINAENFMDRLDTGVALCKHANY
VRQAAEDYLARRQARNKSMTRSMTSGLAGPILALGNVHYLPAAKSGTFFSRDNVSNFITW
CRKSLKIIECLLFETDDLIMRKNEKHVILCLLEVARRGAKFGMLAPMLVQMERQIDREIA
ADIKANNSSESGTQTEALNSGGSTTTTTTITTTTVETDLYDDSDDSDNEDDADENPMLMY
GPQPQIITNDLKSLDEMVRDLVEKCTCPSQFPMVRVSEGKYRIGDTKVLIFVRILRSHVM
VRVGGGWDTLSHYLDKHDPCRCRAQHRSSVAARLIPRQSPNHNPSNGIELHKAQVIFERS
PPAARRVFQSTANCNGGGSGAGSGTGSGAAPVQNGNNSLSPNSGKYRSRSPTPQRKFLNQ
QQQQPLSNGGSATGAAPEPTNGQYLASPSLARRSMSPSPRRLIDMRKKQNSLDSYSNGPK
SLPGFSCSLEDSAGSGANGGGTVGSGGATNGSGSGGEQGNASKFENISDNGSEISDEGYR
SLGVIQSSNAQKRESLHSQASIEDAESNARLDQTSSDSQISPSEEPTEKAAGDILEEEDA
LNGQDQDQDHDYSVCDGPQSLPAILCVPHKLEDKFEQSGVFITDDEITVDMGQNQTNNPS
LVAPQSAVPALSKIPRSPLAQRRRSIDNSTCGGAGGSLQDLSSRSSLPAPAFSRKQPVYR
SVRTRSSTNAAPAPAPLRSRQNTQLPMVRDVTNTWSGRGQGAAGNKRRPPVTADNFVAPS
PSAFERNSKARSSQILYDSNGRRVRSGGPGCTSSLTTSPVKNHASSPLAQQLLEAASSAK
NDAQILEKMKTLLSRYAAGNQATAGGSGTGSGSGSGSGSGSGSGKNGNGKKTPVYEDFTS
AWVHSNGNLERSESCSPPAKARSKRSSAASSCDSNGGGNSVATGNPGASVVSPRRERGMS
KIPAPVRHNTELY
Download sequence
Identical sequences B3MZ55
FBpp0125461 7217.FBpp0125461 XP_001966611.1.52611 XP_014759872.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]