SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7217.FBpp0125740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7217.FBpp0125740
Domain Number 1 Region: 61-171
Classification Level Classification E-value
Superfamily FKBP-like 4.38e-34
Family FKBP immunophilin/proline isomerase 0.0000135
Further Details:      
 
Domain Number 2 Region: 2-40
Classification Level Classification E-value
Superfamily WW domain 0.0000000000949
Family WW domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7217.FBpp0125740
Sequence length 173
Comment (Drosophila ananassae)
Sequence
MPDAEQLPEGWEKRTSRSTGMSYYLNVHTKESQWDQPTEPAKKAGASSGGGASGGGSGGD
APDEVQCLHLLVKHKGSRRPSSWREENITRTKEEAQLLLEVYRNKIVQGEATFDELARSY
SDCSSAKRGGDLGTFGRGQMQPPFEKAAFGLNVGQLSGIVDTDSGLHIILRKS
Download sequence
Identical sequences B3MVR6
7217.FBpp0125740 FBpp0125740 XP_001965546.1.52611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]