SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0145177 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0145177
Domain Number 1 Region: 242-372
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-28
Family C-type lectin domain 0.002
Further Details:      
 
Weak hits

Sequence:  7222.FBpp0145177
Domain Number - Region: 96-140
Classification Level Classification E-value
Superfamily Tropomyosin 0.015
Family Tropomyosin 0.0048
Further Details:      
 
Domain Number - Region: 113-201
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0608
Family Fibrinogen coiled-coil and central regions 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0145177
Sequence length 376
Comment (Drosophila grimshawi)
Sequence
NTCGKFCFKVVKPILGHMAALQIKTIDQEDKEKSVLQSKLDNIEKELTCEKDAQLENTCG
KFCFKVVKPILGHMAALQIKTIDQEDKEKSVLQSKLDNIEKELKQVKVDKDNCPDQSELL
KQNADLQSKLENMENELTGEKEAQLENTCGSYCFKVVKPILKQSVALQEKIMDQEDKEKS
DLQSKLDNIEKELKQVKVDKDNCQKQSVDLQLKQEYMEKDLVFLHKKIDEHDQKLKDAEQ
TFKGQPELFKQIGSKYYYIEEHATMNWYAAAHRCHQLGAHLASIQNQKEYDAIIAKLNPP
KFYWIDINDLSEEGKFISHTTGNGAAFLNWYPKNNPDNYKGNENCGSFWYIHKRYGMNDD
DCSKKLYFICETFNVK
Download sequence
Identical sequences B4JDY6
FBpp0145177 7222.FBpp0145177 XP_001988639.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]