SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0149462 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0149462
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.24e-46
Family Calponin-homology domain, CH-domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0149462
Sequence length 188
Comment (Drosophila grimshawi)
Sequence
MSSNRAPKSGFAAEAQRKINSKYSEELAQESLEWIKAVTDEPINTSGDTDNFFEVLKDGV
ILCKLANALQPGSIKKVNESKMAFKCMENISAFLECAKNFGVPTQETFQSVDLWERQNLN
SVVICLQSLGRKASNFNKPSIGPKEADKNVRQFSDEQMRAGQNVISLQYGSNKGATQSGI
NFGNTRHM
Download sequence
Identical sequences B4J1D9
XP_001983482.1.65300 FBpp0149462 7222.FBpp0149462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]