SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0151703 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0151703
Domain Number 1 Region: 234-433
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-49
Family DBL homology domain (DH-domain) 0.0000143
Further Details:      
 
Domain Number 2 Region: 40-210
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.27e-26
Family Calponin-homology domain, CH-domain 0.0054
Further Details:      
 
Domain Number 3 Region: 423-597
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-24
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 4 Region: 635-746
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-20
Family SH2 domain 0.001
Further Details:      
 
Domain Number 5 Region: 740-808
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000919
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0151703
Sequence length 812
Comment (Drosophila grimshawi)
Sequence
MATNSFGSIAGTAAALTSTSVSATASAAAAAAAAAGVNADLWRECVAWLVRCKVIPADHK
AALPDAEIRILAMTLRDGVLLCNLIIHLDASSMNAREFNRKPQMAQFLCCKNIKLFLDVC
HNHFNIRDADLFEPTMLYDLTNFHRVLITLSKLSQCRKVQQMHPDLLGFNLQVSPSERSH
SDEAIYKDLHSTTNDNIACNGTAYDHTNTKEEEVYQDLCALHRTSRGQTTSATSFEQRDY
VIRELIDTESNYLDVLNALKAKFMLPLERHLNQDELRLIFPRIRELADIHTKFLEKLHES
VMPNTKHKMGQVFLDFREPFLIYGEYCSCLLNAIDYLADVCKKNQIIDQLVQKCEREYNV
GKLQLRDILSVPMQRILKYHLLLDKLVKETSPLHEDYRSLERAKDAMIDVSQYINEVKRD
SDHLVIIQKVKDSIFDLNLPQNGNDLLQYGRLLLDGDLHIKAHEDQKTKMRYAFVFDKIL
ILVKALHIKTGDMQYTYRDSHNLADYRVEQSHSRRTLGRDTRFKYQLLLARKSAKTAFTL
YLKSEHERDKWRKALTEAMESLDPPGCRNTDHKMEIYTFDAPTTCRHCSKFLKGRIHQGY
RCKVCQISVHRGCISSTGRCKQNPVSIPPPVCDRQLSEFNWFVGNMDRETAANRLENRRI
GTYLLRVRPQGASSPHETMYALSLKTDDHVIKHMKINQENDGESMLYCLSSRRHFKTIVE
LVSYYERNDLGENFAGLNQSLQWPYREVIATALYDFDPKAGSNQLQLRTDCQVLVIGKDG
DSKGWWRGKIGDTVGYFPKEYVQEHPATSDEL
Download sequence
Identical sequences B4JWP8
FBpp0151703 XP_001995522.1.65300 7222.FBpp0151703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]