SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0155661 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0155661
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.01e-47
Family Calponin-homology domain, CH-domain 0.000000544
Further Details:      
 
Domain Number 2 Region: 302-365
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 2.22e-20
Family EB1 dimerisation domain-like 0.0003
Further Details:      
 
Domain Number 3 Region: 175-216
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000004
Family Calponin-homology domain, CH-domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0155661
Sequence length 377
Comment (Drosophila grimshawi)
Sequence
MAVNVYSTNVTSENLSRHDMLAWVNDCLQSQFSKIEELCTGAAYCQFMDMLFPNSVPVKR
VKFRTNLEHEYIQNFKILQAGFKKMSVDKIIPVDKLIKGRFQDNFEFLQWFKKFFDANYD
GRDYDPLAQRGGIKLGNGSGSHTGSGVGSTNNDLHIMHRRPQQHPHQHPQQQHQHIIPID
KLIKGRFQDNFEFLQWFKKFFDANYDGRDYDASGVREGAPMGFGSGAVKSLPGTSGGGGV
ASSYRRVPTAAQTRTAAATTTATKPISKVPPRTNNATPPNRMIAGTGAVKKNDAAGAASN
HQIEELSNQVMDMRLNLEGLEKERDFYFTKLRDIEILCQEADEAEPAQLIQKILDILYAT
EDGFAPPDDAPPEDEEY
Download sequence
Identical sequences B4J6K4
7222.FBpp0155661 XP_001987138.1.65300 FBpp0155661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]