SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0155998 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0155998
Domain Number 1 Region: 49-270
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.58e-63
Family Calponin-homology domain, CH-domain 0.00027
Further Details:      
 
Domain Number 2 Region: 1496-1586
Classification Level Classification E-value
Superfamily E set domains 1e-18
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 276-375
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.07e-18
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 
Domain Number 4 Region: 1308-1408
Classification Level Classification E-value
Superfamily E set domains 1.47e-17
Family Filamin repeat (rod domain) 0.0034
Further Details:      
 
Domain Number 5 Region: 1140-1223
Classification Level Classification E-value
Superfamily E set domains 3.62e-16
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 6 Region: 567-657
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000127
Family Filamin repeat (rod domain) 0.0068
Further Details:      
 
Domain Number 7 Region: 1419-1503
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000667
Family Filamin repeat (rod domain) 0.0034
Further Details:      
 
Domain Number 8 Region: 468-562
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000801
Family Filamin repeat (rod domain) 0.0029
Further Details:      
 
Domain Number 9 Region: 1228-1320
Classification Level Classification E-value
Superfamily E set domains 0.0000000004
Family Filamin repeat (rod domain) 0.0076
Further Details:      
 
Domain Number 10 Region: 392-466
Classification Level Classification E-value
Superfamily E set domains 0.00000667
Family Filamin repeat (rod domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0155998
Sequence length 1631
Comment (Drosophila grimshawi)
Sequence
MDVKDIKGAKVTHAGLLKHNTDGTTETQKITHAGLVARSPEGTAAKGMNIRGNEDLWVEI
QANTFRNWVNEHLRETGMQVHDWATDFCDGTCLCALVENLQTRPLKPSWNRRPANQHHYL
ENATTALKSIEADHIKLVNIGNVDIVNGNVKLILGLIWSLIVRYQIGRSKFPPRKLMLAW
LQAALPDCKITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCTNAMNLAQRE
FNVPKVLEPEYLASPWLDELSGMTYLSYFMKPGGPGYNATMRWVNTQVKDQVKNFTSDWN
DGRVLCEIIKGLGGSAPAPDKLSTDPFHYENNIRKAVDAGAKLGVQPILTPKDMANPEVE
HLGIMAYAANLQWVTPRPPLSDSVNVYLESTSGRVGEPTHFRIDVLSRDISLSSVRCHVV
PPSGQPGHPVRLNAHGEGVYVPERYGMHEIVVEIGEDSLGGHFFRVLPRLMQVAPPGMAP
CALGSLVEVLVNATGAPKTEDILVTAVSPTGISHNCPLKKIDEGHSAIFKPDEAGIWEIA
ITYQGRHIQGGPFTCAVFDASGVSVHGLDGAMPLRAHTFEVDARGVGVNGELHVDIVHDK
HSLVCSVEKIVENKYRVTFMPRQNGKYRVYIYFNGYDVKGSPFIMRVGTKGRSGKTRSSP
LHESKHRSESPSMHFISTTNARHNDYRNASLSRRDLHSHNTAERTSSYSPQYSPKLDTTD
YHSSSSRYYKRESEENHGSPTPPLTTATTGGSPTVKYLNSADLYTETGGARRDSKTSNSS
STKNDYYYDKENELYSQRRVISKPTLAPPREERDLTATSNTQSSSSTSYQRHQQHQQLTH
SLSPIPSPTLNTRSSEMHSHSPLTIKTSNQYETSTRNISNSPRHASASPVQRYSPNNAYI
STATHRIGSPVTSTLNKNGFESTRVEKSSTYKSTSNYVTDSNVRASPSLYGTTERMRRIG
SPEPRIDHSSNVRVSSMKPASARRDSWDVINKTKHMLSHNSLESLANMTETQLNTELNYT
RPDLDNETQRNTQYNKFALHKQQQQQQQQQHQSDYRRDSPDDGERYIPSAITVKSHSNNT
YTDRSGGYTKTVKESSEHVVTESNGHSPSIANNNSGTGYGYSSLSRFRPIDSNATGARAI
RVQNIPNGSIGRPVEFEIDGSKAGSGNLEILVNGGRVTSSVRSLGGQRFIASFTPHEHGT
HTVQITFNGETVPGSPWHAEIMSSPGLTALGESTRLVPANTPAVFEILPPPGQSLSKGEC
VATVLTPNKSKLNARVTHEAANGAARIEFVPTEVGTHIIDASINGTKIAGGPLIAKVYDA
SLIQVTEVNGGVVGQPCQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQ
AKSHLIDIKFNGETVRGCPFVCAVADTSRVLLNLTNLELIPVNRPSSFHITVSGGGAAEL
AVSVRGPQGELPVRVTGDIHAGFTAEFTPSNVGSHSINVEYNGFAVQGTPFMAKSYDASK
VVVGSVSRGTMGRPVQFTVDAGDAGEGNLEITISAKGQNIPTQVHPQGSARFSVSFVPTE
SCEHTINVSFNKMPVPGCPITVSISGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIE
VNVEGRRNLLY
Download sequence
Identical sequences B4J422
7222.FBpp0155998 XP_001987761.1.65300 FBpp0155998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]