SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0156863 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0156863
Domain Number 1 Region: 22-143
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.33e-47
Family Calponin-homology domain, CH-domain 0.00000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0156863
Sequence length 202
Comment (Drosophila grimshawi)
Sequence
MMDRESLSEWAKDKPLSILQLDPADRAVLRIADERDAIQKKTFTKWVNKHLKKANRRVVD
LFEDLRDGHNLLSLLEVLSGEHLPREKGKMRFHMLQNAQMALDFLRYKKIKLVNIRAEDI
VDGNPKLTLGLIWTIILHFQPEPEILSSHLNMADEPTRCFDSDSKIGQECYIFGEPNQLT
GLPTYCYASSNHITRRLKNQIT
Download sequence
Identical sequences B4JW22
XP_001995088.1.65300 FBpp0156863 7222.FBpp0156863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]