SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0156864 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0156864
Domain Number 1 Region: 217-334
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.9e-31
Family Calponin-homology domain, CH-domain 0.0000257
Further Details:      
 
Domain Number 2 Region: 1702-1909
Classification Level Classification E-value
Superfamily Plakin repeat 8.72e-26
Family Plakin repeat 0.0052
Further Details:      
 
Domain Number 3 Region: 344-461
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-25
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 4 Region: 1974-2102,2167-2190
Classification Level Classification E-value
Superfamily Plakin repeat 1.31e-22
Family Plakin repeat 0.02
Further Details:      
 
Domain Number 5 Region: 2324-2392,2421-2501
Classification Level Classification E-value
Superfamily Plakin repeat 2.62e-22
Family Plakin repeat 0.0088
Further Details:      
 
Domain Number 6 Region: 1514-1612,1650-1697
Classification Level Classification E-value
Superfamily Plakin repeat 2.56e-21
Family Plakin repeat 0.0029
Further Details:      
 
Domain Number 7 Region: 2503-2638,2682-2704
Classification Level Classification E-value
Superfamily Plakin repeat 2.96e-19
Family Plakin repeat 0.0064
Further Details:      
 
Domain Number 8 Region: 751-872
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-18
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 9 Region: 662-793
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-16
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 10 Region: 1231-1332,1366-1390
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000826
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 11 Region: 1159-1261
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000461
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 12 Region: 600-694
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000878
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 13 Region: 2686-2769,2801-2829
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000602
Family Plakin repeat 0.021
Further Details:      
 
Domain Number 14 Region: 1000-1149
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000942
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 15 Region: 433-559
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000489
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 16 Region: 878-932
Classification Level Classification E-value
Superfamily SH3-domain 0.0000478
Family SH3-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0156864
Sequence length 2987
Comment (Drosophila grimshawi)
Sequence
MHSSTSSQSTLKRTQQLVRQQNGSQPYVSGGTEIVHTSRGPPITTNIDDSSLRYRQETKR
ERTVEAVITDYPGVAPPGTLPHERSHIERTVTFQDGVGGSGSRRITTDSRALVPSAAPGG
VSSSSYQQVTRNKRISTEVLGSSVESTKTSQRAPNGHRRVTTHIVRKVTTLSRAEENQQP
AEDLLPPAKMIRSSELEYRRALPPPAIVESSVQRREISDIVVGKEDNVSAREALLRWARR
STARYPGVRVNDFTSSWRDGLAFSALVHRNRPDLLDWRKARNDRPLDRLETAFHIVEKEY
GVTRLLDPEDVDTNEPDEKSLITYISSLYDVFPEPPSIHPLFDMESQRRVHEYRDLAQQF
IYWCREKTAYLQERSFPPTLIEMKRLLSDLQRFRSEEVSARKREKSKLIQIYKELERYFE
TVGEVDVEADLRPDAIEKAWYRMNTALQDREVILQQEIERLERLQRLADKVQREIKHVDH
KLTDLETRVSEEGRRIERLHPVDAKSIVEALETEIRHLEEPIQDMNQDCHVLNEGRYPHV
SELHKKVNKLHQRWAQLRTNFHTNLVQKLSGLKFPVHETTVTRQTRMVVESRQIDTNPHF
RDLQEHIEWCQNKLKQLLAADYGSDLPSVKEELDRQQHEHKIIDQFHSKILNDERQQSKF
SGDELNLYQQRLNQLQKVYDELHSTSTKRLTDLDSLQHFLAQASAELQWLNEKEQVEITR
DWADKQLDLPSVHRYYENLMSELEKREMHFATILDRGESLLNQQHPASKCVEAHLTALQQ
QWAWLLQLTLCLEVHLKHTTEYHQFFAEIKDAEQWLSKRDEILNSKYSQSDFGLDQGEAL
LRGMQDLREELNAFGETVSTLQRRAQTIVPLNKRRQPVNRQGPVQAICAYKQQGQLQIEK
GETVTLLDNSGRVKWRVRTAKGQEGSIPGACLLLPPPDQEAIDAAERLKRLFDRSVALWQ
KKHLRLRQNMIFATIRVVKGWDFDQFLAMGPEQRTAIRRALNDDADKLLSEGDPNDPQLR
RLRREMDEVNRLFDEFEKRARAEEESKQASRIFTEECIAIKSKLEDMARELDQIILAPLP
RDLDSLEHVLEIHSDYERRLHLLEPELKHLQETFRTIALKTPVLKKSLDNLNELWKELNT
QSGLHKDRLKLLEASLAGLEDNEHVISELENELAKHQDLPSTAEGLQHVFKQLTHMQDII
TQQQPQMDKMNDAADQLGRMGVPTKVLGDLKRLHSNVERLNTRWSAVCNQLGERMRSCET
AIGLMKNLQSSVQVEESWVDGTTERLSAMPTATSAYELDKLLGAAIERKPKIENVNVAGG
RLIREAKIYDSKCLRFVDWLLEARPSFSPPRRDLRPADSDPGATQYYSQRLDNLNTKYDR
LLEQLSQRLKTAIEVNGSDGLQYAESLQKPLKTFRVDFSAGSVPPGDGYAARPDDLYTTT
YSTTQFSSTKTTKSSSKSIYSSDGIDATISQESNAATTPQSQIQFNEIRSLKRMQQLGGS
AGGGGGGNGTSVLDIAGIRDPRTGRVLTIGEAIQLRILDVRTGEMLVGDKRITLEQAAQQ
GLIDAQLALQLLQPGAGRDASGRELSLLEVIQREITEAETGYETAEKRIKVNSTVEMSQS
QPKSDVATSPEKPRNIVDAICAGSVDAKTGLYRVKSGQTISLAEAYERGYLIRHESVTIK
SNALCLSDAIAHGLVDSSGWIIDRNSGDKFRLDSAIANQLIDASVREVVDAKRDVKITLQ
SALQSGVLNAKTGRYLNEVTKEKLSFLEARNRQLIVKPYTLKDICDLNLLDKQSLITSPM
RREKLSIMQAIESGVLDGNQLKCITKRKGELITLQEAIADGIVLPAECKYRDFMTGELIS
IPEAVERGLISSVAQRSIFDIDGFKDLRSNDYVSFNVALSRDLLRRKSTGFALETGRDSL
VPLEVAVGEGLVRQEVYEMFSRGIGVHNASGKELSVFDLVYHNLIDPKTGYLLDPKTGET
VPLDTAIERKFITPEGALLLSSLLNITLTTETVTRTINRYVTIRAGSQEPGDTVLLTFTE
AVRQGFIDEDRQLFKDPKTDNVYSVQQALNYGLLVPDSNQTVPEPTNRKKTKSTITIVTK
QIMPEAEPIKLNTQHMKYVEKSVEIPISQELIKPQRVVSEFINQEKSSYLEQNVTERQIM
ELPPGGWRLKDVIEQRLFNPDTGVFHVQGTDRLVNFEECIDKQIINNLSVAVIEPSTGDK
ISVKSAFERDILDGYGNYTNNRQQVIGMRNAISEGKILLESVPATRGANQNTILRITRVN
NMPDVLEVSTPLKDAPPRFLEVNTCQRELASPEPLQIAPGAIYDPSTALVIFTQSGETEN
IFDAARQGLIDEQLIKILDPATKKTISVTEAIARSIYDPRTATILNAEGQPVDLITATKL
GLLTVVGAPLVAAEGALRTVRFVVDPRTGEQIPVEVAYERGIVSRDQLQRGRSFESDHTT
EEKVVVLQKMRKIILKPRDALRKGIIDEETCAILEDTRNFTNPQGEVVNISEALNLGLID
GRRGQVTDPQRNRVLNLRQAVEQKIIDPEQTNHILMPLAKSLSIPKLESQGLIDTKTQTI
VHPESGYPLSIHEAIVCEVLDPHSKLQKPTKCTLEEAIEKGIINPDESTFSYKNKTLNIS
QAIDANLFDASYDKQKLRVEIPPVGMIFPVAVEKSLVEPTKRVVLHPSTKKPLPIKQAIE
DNFIMSIPYAPKPDAIELVAALERNLIDVAAQTFTHPTSGERFSLRQALENGELVVKQLS
DFVVTQKPIAKTEVMETVRAVHTVTTKTIELMQGYVLISNNEVQNVNTGEVVSLEQAKEL
GILREEEVTRETKATAGDNVEQLTPQTVPSSSDQTVVVEERTQTVVVSSDTRKQEMQVVS
TTQSTKESPEKETKSPSKEPNKTLQNVKDVAKMGALGVIAAPVLAGGAIVSGVKSLLKSK
KSPTETTATTTTTTNISSTLISGKEPEKPQKPEVSFIDEERKVAQPQ
Download sequence
Identical sequences B4JW23
7222.FBpp0156864 XP_001995089.1.65300 FBpp0156864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]