SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0157364 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0157364
Domain Number 1 Region: 91-192
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 7.89e-16
Family Myeloperoxidase-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0157364
Sequence length 195
Comment (Drosophila grimshawi)
Sequence
MSMSRQIQQKILALLTTFFCQTMEPRLSAATEIKISFCLAITIRCVLQFCPREETIFTTA
STMLGALLLLARIATLELQSSFFSHCSNILPLTKLFELKNEIYKPRLQYTSKKLNEILQS
LLHERAMKMDSSYVDALVWHEPTKPAHADVLAFDIQRGRDHGLQPYYKYLEICNRNKKIT
SWSDFEDFIPKEVSY
Download sequence
Identical sequences B4K2R0
XP_001997564.1.65300 7222.FBpp0157364 FBpp0157364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]