SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7222.FBpp0158316 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7222.FBpp0158316
Domain Number 1 Region: 20-253
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-86
Family Calponin-homology domain, CH-domain 0.0000212
Further Details:      
 
Domain Number 2 Region: 295-418
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-32
Family Spectrin repeat 0.00000262
Further Details:      
 
Domain Number 3 Region: 532-652
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-26
Family Spectrin repeat 0.0000144
Further Details:      
 
Domain Number 4 Region: 419-528
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-23
Family Spectrin repeat 0.00000597
Further Details:      
 
Domain Number 5 Region: 656-768
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-21
Family Spectrin repeat 0.0000148
Further Details:      
 
Domain Number 6 Region: 761-895
Classification Level Classification E-value
Superfamily EF-hand 5.85e-21
Family EF-hand modules in multidomain proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7222.FBpp0158316
Sequence length 921
Comment (Drosophila grimshawi)
Sequence
MMMENGISMEYGDGYMEQEEEWEREGLLDPAWEKQQKKTFTAWCNSHLRKAGTAIDNIEE
DFRNGLKLMLLLEVISGETLPKPDRGKMRFHKIANVNKALDFIASKGVHLVSIGAEEIVD
GNLKMTLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGL
AFCALIHRHRPDLIDYAKLSKDNPMENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERA
IMTYVSCYYHAFQGAQQNTALPDERAVMTYVSSYYHCFSGAQKAETAANRICKVLKVNQE
NERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQK
AKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLER
LEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRV
EQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILH
LEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNL
VREVESIVKQHQIPGGLENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEML
RRQFAEKANVVGPWIERQMDAVTAIGMGMQGSLEDQLHRLKEYEQAVYAYKPNIEELEKI
HQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEF
RSSFNHFDKNRTGRLTPEEFKSCLVSLGYSIGKDRQGDMDFQRILAVVDPNNTGYVHFDA
FLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPN
GVHGALDYMSFSTALYGETDL
Download sequence
Identical sequences B4JM22
FBpp0158316 XP_001992076.1.65300 7222.FBpp0158316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]