SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0071306 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7227.FBpp0071306
Domain Number - Region: 75-161
Classification Level Classification E-value
Superfamily Prefoldin 0.0262
Family Prefoldin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0071306
Sequence length 193
Comment (Drosophila melanogaster)
Sequence
MLLSEDRLEHYKTSLEQQLKHLATTIRSYLCLKSATTPQLSNQANRLWELGQRYRLVTGS
NQVATFALLSVCHDVYRSLQDSISKLVSELGQISAQVTDFEIECLHLCNEQQQTKTPAAL
TEFRNFLEESLKLLQNQVKYLELHLSQLQPKFSAPESSLESFKSDLQLPEPAEARITLGL
AKIERLSSFPLTL
Download sequence
Identical sequences Q9W333
NP_572569.1.81976 FBpp0071306 FBpp0071306 FBpp0071306 7227.FBpp0071306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]