SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0071828 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0071828
Domain Number 1 Region: 49-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-61
Family Calponin-homology domain, CH-domain 0.00031
Further Details:      
 
Domain Number 2 Region: 2846-2953
Classification Level Classification E-value
Superfamily E set domains 2.55e-26
Family Filamin repeat (rod domain) 0.00056
Further Details:      
 
Domain Number 3 Region: 2742-2856
Classification Level Classification E-value
Superfamily E set domains 1.93e-25
Family Filamin repeat (rod domain) 0.00089
Further Details:      
 
Domain Number 4 Region: 2269-2380
Classification Level Classification E-value
Superfamily E set domains 4.4e-20
Family Filamin repeat (rod domain) 0.0045
Further Details:      
 
Domain Number 5 Region: 2382-2473
Classification Level Classification E-value
Superfamily E set domains 9.34e-20
Family Filamin repeat (rod domain) 0.002
Further Details:      
 
Domain Number 6 Region: 1830-1933
Classification Level Classification E-value
Superfamily E set domains 1.53e-18
Family Filamin repeat (rod domain) 0.0039
Further Details:      
 
Domain Number 7 Region: 1487-1577
Classification Level Classification E-value
Superfamily E set domains 2.07e-18
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 8 Region: 1667-1755
Classification Level Classification E-value
Superfamily E set domains 7.34e-18
Family Filamin repeat (rod domain) 0.0041
Further Details:      
 
Domain Number 9 Region: 1586-1675
Classification Level Classification E-value
Superfamily E set domains 9.34e-18
Family Filamin repeat (rod domain) 0.0047
Further Details:      
 
Domain Number 10 Region: 2030-2126
Classification Level Classification E-value
Superfamily E set domains 3.94e-17
Family Filamin repeat (rod domain) 0.0029
Further Details:      
 
Domain Number 11 Region: 1955-2041
Classification Level Classification E-value
Superfamily E set domains 5.14e-17
Family Filamin repeat (rod domain) 0.0054
Further Details:      
 
Domain Number 12 Region: 285-384
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-16
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 
Domain Number 13 Region: 1299-1399
Classification Level Classification E-value
Superfamily E set domains 1.67e-16
Family Filamin repeat (rod domain) 0.0043
Further Details:      
 
Domain Number 14 Region: 2644-2763
Classification Level Classification E-value
Superfamily E set domains 7.59e-16
Family Filamin repeat (rod domain) 0.0093
Further Details:      
 
Domain Number 15 Region: 1130-1214
Classification Level Classification E-value
Superfamily E set domains 8.63e-16
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Domain Number 16 Region: 576-666
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000294
Family Filamin repeat (rod domain) 0.0068
Further Details:      
 
Domain Number 17 Region: 1409-1494
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000955
Family Filamin repeat (rod domain) 0.0044
Further Details:      
 
Domain Number 18 Region: 477-571
Classification Level Classification E-value
Superfamily E set domains 0.000000000000153
Family Filamin repeat (rod domain) 0.0029
Further Details:      
 
Domain Number 19 Region: 2197-2289
Classification Level Classification E-value
Superfamily E set domains 0.000000000133
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 20 Region: 1219-1311
Classification Level Classification E-value
Superfamily E set domains 0.000000000621
Family Filamin repeat (rod domain) 0.0071
Further Details:      
 
Domain Number 21 Region: 1765-1852
Classification Level Classification E-value
Superfamily E set domains 0.000000000801
Family Filamin repeat (rod domain) 0.0069
Further Details:      
 
Domain Number 22 Region: 2482-2570
Classification Level Classification E-value
Superfamily E set domains 0.0000000193
Family Filamin repeat (rod domain) 0.0095
Further Details:      
 
Domain Number 23 Region: 400-474
Classification Level Classification E-value
Superfamily E set domains 0.0000327
Family Filamin repeat (rod domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0071828
Sequence length 2964
Comment (Drosophila melanogaster)
Sequence
MDVKDIKGAKVTHAGLLKHNSDGTTETQKITHAGLVARSPEGTAAKGMNIRGNEDLWVEI
QANTFRNWVNEHLRETGMQLMQIPIVSQVHDWATDFCDGTCLCALVENLQTRPLKPSWNR
RPANQHHYLENATTALKSIEADHIKLVNIGNVDIVNGNIKLILGLIWSLIVRYQIGRSKF
PPRKLMLAWLQAALPDCRITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCT
QAMDLAQREFGVPKVLEPEYLASPWLDELSGMTYLSYFMKPGGPGYNATMRWVNTQVKDP
VKNFTTDWNDGRVMCEIIKGLGGSAPAPEKLSTDPFHYENNIRKAVDAGARLGVQPILTA
KDMANPEVEHLGIMAYAAHLQWVPPRPPLSDLVSVYLESTSGRVGEPTHFRIDVMSRDIS
LSSVRCHVVPPSGQPGQPVRLNAHGEGVFVPERYGMHEIVVEIGEDSLGGHFFRALPRLL
QVAPPGMAPCALGSLVEVLVNATGAPKTEDILVTAVSPTGISHNCPLKKIDEGHSAIFKP
DEAGIWEIAITYQGRHIQGGPFTCAVFDASGVSVHGLDGAMPLRAHTFEVDARGVGVSGE
LHVDIVHDKHSLVCSVEKIVENKYRVTFMPRQNGKYRVYIYFNGYDVKGSPFIMRVGTKG
RSGKTRSSPLHDSKHRSESPSMHFVSTTNTRHNDYRNSSLSRHNTAERTNSYSPQYSPKL
DTTDYHSSSSRYYKRESEENHATPPPAPPPASGSPTVKYLNSADLYTETLNGRRDSKTSN
SSSTKNDYYYDKENELYSQRRAVTKPKLTPPREERELTSTTNTSSSSSFQQRHQQLATST
LTRSLSPIPSPTLNTRSSEVHTHSPLTIKTSNQYESSTRNITSSPRHASVSPVQRYSPNS
AYITTATHRMGSPLTSPVSKNGYESSRTVEKSSTYKSTSNYVTDSNIRASPSLYGTAERL
RRTGSPEPRIDHSSNVRVSSMKPASARRDSWDVINKTKHMLSHNSLESLANMTEKQLNTE
LQYNRPDLDHETHRNTQYNKFALHKQQQQQSDYRRDSPDDGERYKPSAITVKSHSNNTYT
DKSGGYTKTVKESSEHVVTESNGHGPSPGYGYSSLSRFRPIDGNATGARAIRVQDIPNGS
IGRPVEFEIDGSRAGSGNLEILVNGGRVTSSVRSLGGQRFIASFTPHEHGTHTVQITFNG
ETVPGSPWHAEIMSSPGLTALGESTRLVPANTPAVFEILPPPGQSLSKGECVATVLTPSK
SKLNARVTHEAANGAARIEFVPTEVGTHVIDASINGTKIAGGPLIAKVYDSSLIQVTEVN
GGVVGQACQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKSHLIDIK
FNGETVRGCPFVCAVADTSRVLLNLSNLELIPVNRPSSFHITVSGGGAAELAVSVRGPQG
ELPVRVTGDIHAGFTAEFTPTTVGGHSINVEYNGFAVQGTPFLAKSYDASKVVVGSVSRG
TMGRPVQFTVDAGDAGEGNLEITISAKGQNIPTQVHPQGSARFSVSFVPTESCEHTINVS
FNKMPVPGCPITVSISGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIEVNVEGPAGQ
SVPAQVHQSADGVFKAEFVPRVVGEHRVNVTVNGLPTAGSPYAAKVYDVSAIKVKNVSSG
TVGKAVTFLVETSQAGPGNLEVTVNGGRVPTSAQAQGQHTYAISFTPREAESHTVELRFN
SQDVPGSPFTCRVAAAARIQSPETMDKVSVGRLFEFVVESDTKPTVEVLGPARRSVPVKI
DALGSSTLGYNVKFEPMEVGDHSVEVRLPGGGHVEGSPFLLKAYSAEKVIVTDIRAGVVN
KSVSFGINASQAGAGNLEIIVAVNGKNVPNFVQSEGNARFKVNFKPTEAATHSLSVRFNG
HPVPGSPFSCHIAAAAASPSMGLPRAMAMGECLKQAAVKMDNTFELEGFDGVEPQIFVTS
PSGDNEHCQLSQHDGGSYSASFRPTTVGRHLISVTANDQHINGSPFSCNVFDVSRVSISG
LEQQYGPANLGVPVTFSVDAAGAGEGTLELVVSTDSSTVKAEVVACARGLYDVTFVPQST
EPHYVNITFNEVAVDGSPFRVDIQQHTQHIQIGSLAAIDFPADDQIVEIFSPDQKSVPYS
INRQTAEFRTHMTGNYTLRFIDRETRQHIGSRTLCVFDPTLVKITEVSEAFCHRPASIGV
SLNEAGQGDLSALVRCGATEVPHTIRGPSKTGVYEIVYQPTRVAPHKISILFNEVPISLK
PLEINVLPASAGKEISVSGLGLYQSRVGKTTSFAIDTVKRPAREFDVVVSGPGGQALPVR
CYQTKNGHLQAEFTINKPGQCVIEVLHQSKPLPGSPFTCESFDSSKVSTQGVTKEPLALH
SPNSFTVRTDNAGTAELEAFAISPSNQSIPVLISEQSDGVYNVEFVPSQPGNYKLTLMYG
GETIPSSPLNFTASSSGVRNDARAAGHGLEVCHRNKEASFVVYCPIAPNVQIERLDEYGE
RIEPKIKALGNNEWRISYTILSVGKYEIRASCPNRGSLPGSPWHISCVESNKVTPVGGWG
TLVDHDGRLILPARIIFDVENAGPGKLVCSIDGIEIPVDKLVDGKMCLNITGENLAAGEH
DLDLTWSGLTITQCPRSAFVTGQQAADKVQLMGRGLAAAQAGEAAHFTIDASNAPAGRPE
VILTSQDNTSLPVSLAQPRPSENIWLASYTPLKSTTGTLNLSVKWNGRLVKGCPLTVAVG
SSMDASKVIVSGEGLRHGIVGKDIKSWIDTRRAGPGELTAHCAGVRKVAYCELYDHGDAT
FTLNIKPQESGRHILTIKYGGQNVPGSPFALKVAGAPDASKVRVYGPGIEHGVLATFQSR
FICDTRGAGAGQLTVRVRGPKGAFRVEMQRESQKDRTILCKYDPTEPGDYRVEVKWAGEF
VPGSPFPVMIFDTEEELRRYLQGI
Download sequence
Identical sequences 7227.FBpp0071828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]