SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0077157 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0077157
Domain Number 1 Region: 8-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-27
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0077157
Sequence length 565
Comment (Drosophila melanogaster)
Sequence
MQNVNQHKHGNSASRRRILGWINNNLGTTYVRLEELRTGAEYCRMLHKLQPSAIRLKRVF
KEPKSHYECVQNMKLLQKSLLKQGVEKQIPIQRLVSRGNSESLEFAQWFKAFYDHNHQLL
WPEKTEDAPKPLEKFDEKPDSFVDTGKCRYGARCSHRLDSTVSSRHSNQSGKNFENYQKK
KTTTTGSNSVGKSENHRKDDSTKHPLWGSLEDFDGYTPEVFNKTYRAAKKYKIVKSRFIR
KHTKRSNKPRNSKTVRIAKSENQKSESAPFIDDPDIVLATEVLASGLDEPRTTQTYMINV
PGVKLGFKPNLFQYPEIIEDYHTILAKKCLLFLDDVHVSFHLDLGELSTLTHDIHRTETD
LKKSDEERVSLIAELDSSPDEWSSTWQSTYENALPIDVIDFKEQHLQQNQSNNCNCADIT
VAGELPQSIEIDLKKIDPEETSRCKNSNGPLLGKRLDRPLPRTRPFKLRRTFGFHEEKSV
KIKSFKYSIKKLVDESPPNSSDEECFSDDFPDVSHFNKEMDAKIVSIWKDIYNVIKILQR
IEQNWYRSKINESRTTFKHWKMNTD
Download sequence
Identical sequences Q9VQX0
7227.FBpp0077157 FBpp0077157 NP_608817.1.81976 FBpp0077157 FBpp0077157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]