SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0077535 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0077535
Domain Number 1 Region: 22-111
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000034
Family Insect pheromone/odorant-binding proteins 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0077535
Sequence length 126
Comment (Drosophila melanogaster)
Sequence
MRVLLAFVLLLGLSVLATKEPEEVKIVSECAKENNVHRKKALDLLMSYRLKKKTHNVMCF
INCIFERTNILQKVKEKVVKENHNCDSIKDADKCAESFQKFQCLVKIEMKRDSAATRHVP
QTMPKL
Download sequence
Identical sequences 7227.FBpp0077535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]