SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0079229 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0079229
Domain Number 1 Region: 19-120
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000879
Family Snake venom toxins 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0079229
Sequence length 147
Comment (Drosophila melanogaster)
Sequence
MQYIYVISALILAIAVQQGYAIKCFVCNSHKDANCALDIPPDNLLKDCDEQYSSRGKGIP
TYCRKITQIIEFSVNSLPPDSRVIRTCAYQNQTSTNYCYQRAGFGGRQVVCSCDTDNCNG
AGAMGASALGVAAMVGLLLSARQYLQR
Download sequence
Identical sequences Q9VLP2
FBpp0079229 NP_001285745.1.81976 NP_609210.1.81976 FBpp0079229 7227.FBpp0079229 FBpp0079229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]