SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0079858 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0079858
Domain Number 1 Region: 25-74
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000101
Family Ovomucoid domain III-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0079858
Sequence length 77
Comment (Drosophila melanogaster)
Sequence
MKYLTLLLVLGLLIALFAGSSEGSYCPCDLKTKGTQVCGSNGVTFKNRCEFECSQRDYKK
LGRTLNIRKDGPCNETN
Download sequence
Identical sequences Q9VKE7
FBpp0079858 FBpp0079858 FBpp0079858 7227.FBpp0079858 NP_001285852.1.81976 NP_652566.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]