SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0079914 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0079914
Domain Number 1 Region: 348-629
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.52e-91
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000941
Further Details:      
 
Domain Number 2 Region: 171-346
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.24e-53
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0000686
Further Details:      
 
Domain Number 3 Region: 631-739
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.02e-29
Family Anticodon-binding domain of Class II aaRS 0.00093
Further Details:      
 
Domain Number 4 Region: 109-169
Classification Level Classification E-value
Superfamily TGS-like 0.000000000000019
Family TGS domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0079914
Sequence length 747
Comment (Drosophila melanogaster)
Sequence
MLKLAPQGGRYYSQISRICQWILPKIQTQSKPPKQQQQQQPQLKEQQQHSYATLAAKMKK
EKKEKPSGGGDTRKELSPLPKYIEERNVFWEKCKAEYEAELAAKKREPIKVTLPDGKQVD
ATSWETTPYEVARGISQGLADNTVISKVNGEVWDLDRVLEGNCTLQLLKFDDPEAQAVFW
HSSAHIMGEAMERIYGGHLCYGPPIENGFYYDMHLEGEGISTNDYGAMEGLVKQIVKEKQ
NFERLEMKKSDLLEMFKYNEFKVRILNEKVTTDRTTVYKCGSLIDLCRGPHVRHTGKVKA
LKITKNSSTYWEGKADAETLQRVYGISFPDPKQLKEWEKLQEEAAKRDHRKIGREQELFF
FHELSPGSCFFQPRGAHIYNTLMGFIKAEYRKRGFQEVISPNIYNAKLWMTSGHWQHYAE
NMFSFEAEKEKFALKPMNCPGHCLIFDNRNRSWRELPLRMADFGVLHRNELSGALTGLTR
VRRFQQDDAHIFCAPEQIKSEMKGCLEFLKYVYTIFGFSFQLVLSTRPDNYLGELEQWND
AEKALAESLNEFGMPWKENPGDGAFYGPKIDITIMDALKRAHQCATIQLDFQLPIRFNLS
YIADDGEKKRPVIIHRAILGSVERMIAILTENFAGKWPFWLSPRQVMVVPVGPAYDQYAQ
SVRDQLHDAGFMSEADCDAGDTMNKKIRNAQLAQFNFILVVGDKERSSNTVNVRTRDNKV
HGEVSVAELITKLQKIRDEFIANEDSF
Download sequence
Identical sequences Q9VKB0
NP_001285868.1.81976 NP_723725.1.81976 FBpp0079914 FBpp0079914 7227.FBpp0079914 FBpp0079914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]