SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0080522 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0080522
Domain Number 1 Region: 55-281
Classification Level Classification E-value
Superfamily L domain-like 1.64e-35
Family Leucine rich effector protein YopM 0.05
Further Details:      
 
Domain Number 2 Region: 662-756
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.3e-21
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0080522
Sequence length 1135
Comment (Drosophila melanogaster)
Sequence
MAATVYQRLHSVAVGVGSAAGSAIGSGSASLPGSGTGSGSGIGHAGNTSSSTSSALLSHS
QLTRSLERILEEAHFSGELILTNRKLKDFPRTGTKYSLTDTVIADLSRNRFAELPEEVTT
FAFLETLLLYHNTIRSIPESVKQLSSLTYLDLRSNQLSSLPREICFLPLQVLLVSNNRLT
SLPDELGRLDQTLTDLDASYNQLANLPARLGELRSLRSLSLRSNHLLYLPRELTCLSLIS
LDVSNNKIASLPLEIRHMSTLVELQLENNPLTSPPASLCMRGLVHVFKFLETQATKDEKG
SRSGGNYDGYTTLRRAPRHNSSGNVLEASTTGSTNNQRRHQVDSGYNTSDGLDKRWSHDA
PTKSKTDSPLHCVSNSTAATLPRTLPSAVHSQADLMDASLTSSTSTIVDESLTLSPTASP
CKLSYAHSNSSSNGSSPDQDDDIMLDHQERTVHHANGRSGKGLGNIQTYKEYKEALKQQR
NQEISVYKQKHPNANHSPNDDEDLSPSPPSISNGSSSNTLPKSIMKQNSNQIGHNGNGNG
SANGNGVDDVVIPKKPIQKVIPSRITEIKPASTSDIRSANSSDCLGYVKPQSPMKNGTSK
FNTSNGGGVQTTVGIVSSTTIKSPVSSTTKLGTVKTHRSVTWNHDIPAEKLSFTMRREFD
RQREETELMSQLRTIIETRLKMTLPVDIASALTDGVILCHLANYVRPRSVASIHVPSPGV
NKLTMARCRRNVDNFLEACRRIGVDEELICSCEDVVPQIEPQQPQLPRADDDYDADVYVQ
DDGSISRSNDSSHLQCSDDCNSSSNHINRVPNALALLRTVSALIAMDENPYHQQLHHHLQ
LQLEQQHFEQEQFSEPTTCSQQQEQMLLLQQQQQQLEHVLYENGLPRAENDDGVEDRDDD
IGKRQQQLATVGQMLLKAKQKTYEKIKHNLLSAHGQHNFQGNNNNRMLHTIVENEHDVAA
AGPAGHYQIIDEKQEEDPYQPKSEDLKDAAALGNATKEAISKRIEFFEQQKSGKPKLEVF
SIYLPKEKTKELELEQKIKAKTNEAGSSILKHDSHTLTVILSCVFIATFLWLNLICCAAD
VLEGKGAVQVAITVGELFRLHGNGGCGSGNSSGAATPTKSPTRTTRATMSPTPLA
Download sequence
Identical sequences Q9VJE6
FBpp0080522 FBpp0080522 7227.FBpp0080522 FBpp0080522 NP_609834.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]