SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0082822 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0082822
Domain Number 1 Region: 449-543
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000034
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0082822
Sequence length 553
Comment (Drosophila melanogaster)
Sequence
MKICLGKVILFTRSLRETFAESQESGNQEQSSKALVLLRCTRYIKRLSMVLTLLETEEGL
NKVNKTLFQLDVDTILFELECIVKEALKSLSVSRFPYQESSCTTTETLVKESPICELNKL
RLMLKNEKKKQELEIMGHNLIIMKEKTLVLQARKNQRAAENRLAEKQDRIKALEECLANC
KFQLKNVNEQYQKLKKASNQLIRESNQIRPQKSWSVLVGRRKGRISTRTSFVWKSLKLDQ
SERETLMGLKKRLSEEKEIKLRAKTEMSKIRKAMDELCLGKGELQFGLQNKSETDASKDT
LVVIDKALSALSQYNTLKFPDCNFQLSRLMKSLYGSLTTIRDRWIRKISSAVEPTPSCLK
SNTPSLPEPPLTVSFSTDLFWDKIYKPCTQSNPVMPNTSLIPVLPKKQPKSLQLTCEPSV
QYKVASRSSTTAPVPKYLGKTFGDRRLSLLRWCQERVKPYGIPMYEFSASWISGRALCAI
IHSYLPDLIDKTYLAKKKPEEVLAYGIKVAKSIGVSDSVDLIRELRQGRPNLEKIVDFVE
ELQGYLDMYDTNI
Download sequence
Identical sequences Q9VEQ5
7227.FBpp0082822 FBpp0082822 NP_524801.1.81976 FBpp0082822 FBpp0082822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]