SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0085012 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0085012
Domain Number 1 Region: 180-263
Classification Level Classification E-value
Superfamily TPR-like 0.000000555
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0085012
Sequence length 550
Comment (Drosophila melanogaster)
Sequence
MAADWRLMLLLGILLLVGGPANGEVYTALAEMEELLETESVLITNLEGYIRVQEDKLNFL
KNKMDEYQREHSDASHDITAYVSNPINAYLLTKRLTTDWRQVENLMEHDVGTDFLQNITQ
YRSLLKFPSDEDLNGAAVALLRLQDTYQLDTSSVARGKLNGIQYSTEMSSDDCFELGRQS
YVNHDYYHTVLWMNEAMARMLEEPTNHTQSFTKADILEYLAFSTYKEGNIESALTMTNEL
LQLLPHHERANGNKRFYEKEIAQQLQLRKMKGDDGTDEMPKSDLPVAKSDPAIFDMTERR
AYEMLCRGELKPSPSDLRSLRCRYVTNRVPFLRLGPLKLEEVHADPYIVIYHDAMYDSEI
DLIKRMARPRFRRATVQNSVTGALETANYRISKSAWLKTQEDRVIETVVQRTADMTGLDM
DSAEELQVVNYGIGGHYEPHFDFARKEEQRAFEGLNLGNRIATVLFYMSDVEQGGATVFT
SLHTALFPKKGTAAFWMNLHRDGQGDVRTRHAACPVLTGTKWVSNKWIHERGQEFRRPCD
LEEDHGEFAI
Download sequence
Identical sequences Q9VA69
7227.FBpp0085012 FBpp0085012 NP_733371.1.81976 FBpp0085012 FBpp0085012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]