SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0087088 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0087088
Domain Number 1 Region: 86-200
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.81e-30
Family CAD domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0087088
Sequence length 266
Comment (Drosophila melanogaster)
Sequence
MTAMNADETKLAGMPQGAEEEQEPEREQKKESDGAAAAAGVQCDPDSRIVAPPPRQRTLT
RTAELDADCEDIELDADDGLDDAADSITLELALSPHSSATPTPSPTTADEDFAQLDNSKP
FKIKDITRNIRKAVVATTLSELRTKVSLKFERAQPAIHLDCDGTEVDDEEYFSTLEPNAE
LIAVFPGEQWRDPSDYNANLRRTSLDAQRLRSLVSKLQPNYMNDDDLDKLSNMDPNSLVD
ITGREPKDNEYSARSDAARLSTELSC
Download sequence
Identical sequences Q0E9B7
FBpp0087087 FBpp0087088 NP_610722.2.81976 NP_610723.2.81976 FBpp0087087 7227.FBpp0087088 FBpp0087087 FBpp0087088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]