SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0112228 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0112228
Domain Number 1 Region: 419-620
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-48
Family DBL homology domain (DH-domain) 0.0000141
Further Details:      
 
Domain Number 2 Region: 19-151
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-28
Family Calponin-homology domain, CH-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 626-786
Classification Level Classification E-value
Superfamily PH domain-like 6.89e-25
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 4 Region: 824-935
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-19
Family SH2 domain 0.00098
Further Details:      
 
Domain Number 5 Region: 929-996
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000551
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0112228
Sequence length 1001
Comment (Drosophila melanogaster)
Sequence
MASSSSSNSFGGVAGVNGDLWRECVAWLTRCKVIPPDHKAAQPDAEIRILAMTLRDGVLL
CNLVIHLDPSSLDPREFNRKPQMAQFLCSKNIKLFLDVCHNNFGIRDADLFEPTMLYDLT
NFHRVLITLSKLSQCRKVQQLHPDLIGFNLQLSPTERSHSDEAIYKDLHSTDLNMRKTSS
IDASASSSAEYYDRTSQSGSLDENSDITIENGTEDIDDYIEDSLSNMCDSTIDNDAEDAG
VETPLLSDCQGSHVRELSFDLALDVVSSTTDGASNAVTPTPESYARQSQSPLAAAAPSVP
VSAAPGPPMGRLVSTSSSSSSLLVSESQRLQRAAAAVYNYRSSMASTEHEYAYIYSEDDE
KVYEDLCYVTFQAKAKPEVTTDNIACNGTGYDHTNTKEEEVYQDLCALHRTSRSQTASST
SFEQRDYVIRELIDTESNYLDVLTALKTKFMGPLERHLNQDELRLIFPRIRELVDIHTKF
LDKLRESLTPNAKVKMAQVFLDFREPFLIYGEFCSLLLGAIDYLADVCKKNQIIDQLVQK
CERDYNVGKLQLRDILSVPMQRILKYHLLLDKLVKETSPLHDDYRSLERAKEAMIDVSQY
INEVKRDSDHLVIIQKVKDSICDIHLLQNGNGSDLLQYGRLLLDGELHIKAHEDQKTKLR
YAFVFDKILIMVKALHIKTGDMQYTYRDSHNLADYRVEQSHSRRTIGRDTRFKYQLLLAR
KSGKTAFTLYLKSEHERDKWRKALTEAMESLEPPGCQSTDHKMEIYTFDAPTTCRHCSKF
LKGRIHQGYRCKVCQISVHKGCISSTGRCKQNPVSVPPPVCDRQLSEFNWFAGNMDRETA
AHRLENRRIGTYLLRVRPQGPSTAHETMYALSLKTDDNVIKHMKINQENSGDSMLYCLSS
RRHFKTIVELVSYYERNDLGENFAGLNQSLQWPYKEVIATALYDYEPKAGSNQLQLRTDC
QVLVIGKDGDSKGWWRGKIGDTVGYFPKEYVQEQKLASEEL
Download sequence
Identical sequences A8JUQ9
FBpp0112228 FBpp0112228 7227.FBpp0112228 FBpp0074449 NP_001097030.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]