SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0112595 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0112595
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000282
Family Calponin-homology domain, CH-domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0112595
Sequence length 217
Comment (Drosophila melanogaster)
Sequence
MAVNVYSTNVTSENLSRHDMLAWVNDCLQSQYSKIEELCTGAANCQFMDSSFSARKACQI
SYQSGARVHTELQDIAGGLQEDVLRCQLRWQGLRCQRGARGSPNGLRIGSGKVTARHGSK
LRVQQLSTWPIGIDTPSNDVFSDAHSIQGAAAHEQRSPSEQNKRRYQQHGHGQEERRKQL
GQQSANRRDVKSGHVYAHKPGGIGKGARLFPLQVAGY
Download sequence
Identical sequences 7227.FBpp0112595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]