SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0113119 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0113119
Domain Number 1 Region: 458-562
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.68e-30
Family Calponin-homology domain, CH-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0113119
Sequence length 1141
Comment (Drosophila melanogaster)
Sequence
MASVWKRLQRNFKRAAKFQFTASYHDLHLETTAKWRPSNLSIVWTRRSRRVASAPLPWEP
DMMNPLVGNISWPVPDNHTISVTLFKDPRTHELEDKDWTFVIEDVTPMGKKRVLANASIN
MRKYASIESTQQSFTLSLKPVSKKITAASLELTISCVFLREGKATDEDMQSVVSMMSVNN
NDVAPLDDLEDIPDLDGFSEITDNFNDFTQQLEHMTTSLNGCIDVATPQSVPSLSEDPTP
LAESFNPLHFELDADGKREAANKLDLPTAASGGSSGAEESLKTPNGLQHVVDQTPIKSPD
EVKQPKQTPVESLRSKTNEDFDKMVTSTPLEPNVNKDDVKPKKKRALFFTEKEDEQDLRV
ESVKEDTTKTIGDNSTTKEKPKEESQSSKDASSVVVPSAKRPELQPLNLKKSYEPSQTPE
SAPVPASVINESIGSCFSTSGSLNNSLKPVEKIVLKENTPGQDLLEWCKEVTKDYPNVKV
TNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIGFDAAESLGIPRVIEPRDM
NMLTVPDKLAVMTYLHQLRAHFTGKQLKIEQIGSTADESSYVIGDYKSDNLSQNRINFSH
PKSLLLHQNSFDEEINGSNKSEQLSPTSKKDVKNLILYNSKNILDKVLSPTKDKNSINAS
QHANQSPMLSCQTTPPQDESLDKGSQPGGKENSSITTIDPQAASEERQQRLLEQARRLIL
ETRVKSGGSIESPTRPKLERTISPIHNGAEEFYAEHAKKLELKEPGSPSHRLSDPKVLQS
FNAIVERVSPKHEKRGDKLSYIDSELEALEREQEAIDQKASNLEAKLRAVMGGNPSNNRR
GGARNSNPFLRLIRNSIGGGDVIRIKLLDSDDESLFGGGAGSGGGRSGACSEDDDRDTSS
DSVCNSGDELHTRLRPRPRSHSCFVNKNHQSTINTPAHLRPHHVHHVVPYTHMLDSSPSA
LSSQQSSCDNLPACSDDDEVLAVAANGRAASLRRQQDRHRRRRQRRERRSHLCHTPNHCE
TEETEEQLLSQWFTLVNKKNALLRRQMQLNILEQEKDLERKYTMLNQELRAAQSVEDWRK
TEVQREKERLLLEELMTIVDKRDQLVQHLHNQEIAIEDDQEIARKLEHVDISAEKDKCVL
Q
Download sequence
Identical sequences A4UZL3
7227.FBpp0113119 FBpp0113120 NP_995865.2.81976 FBpp0113119 FBpp0113119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]