SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0271746 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0271746
Domain Number 1 Region: 8-123
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.09e-39
Family Calponin-homology domain, CH-domain 0.00000767
Further Details:      
 
Domain Number 2 Region: 161-220
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0000654
Family EB1 dimerisation domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0271746
Sequence length 248
Comment (Drosophila melanogaster)
Sequence
MTDLKLTVALTSVNAENMSRHDMLQWVNNMVHGHFKKIEELCSGAAYCQMMEMIFPNCIN
LKRVKMTAKLEHEYLHNLRLFQEAFNRLKLDKTVPIDRLIKGRFQDNFEFLQWFKKFFDS
QAPGLENIKSLANAPLAKPIKPRQFAKERSPVNANDDALKELIDEMKNLSLKREDIMEAS
NQIYNKLRLVEDLVNDMINNNQLVELCKRIQAVLYKTIDGEINEEPVEVNEDNGDEGAEH
ADPNDGLY
Download sequence
Identical sequences A1ZBF1
7227.FBpp0271746 FBpp0271746 FBpp0271746 NP_611384.2.81976 FBpp0271746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]