SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0289294 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0289294
Domain Number 1 Region: 50-300
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-81
Family Calponin-homology domain, CH-domain 0.0000198
Further Details:      
 
Domain Number 2 Region: 320-441
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-31
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 3 Region: 3094-3249
Classification Level Classification E-value
Superfamily Spectrin repeat 3.86e-30
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 4 Region: 1607-1761
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-29
Family Spectrin repeat 0.00044
Further Details:      
 
Domain Number 5 Region: 2241-2401
Classification Level Classification E-value
Superfamily Spectrin repeat 3.09e-29
Family Spectrin repeat 0.00093
Further Details:      
 
Domain Number 6 Region: 2882-3027
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-28
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 7 Region: 717-833
Classification Level Classification E-value
Superfamily Spectrin repeat 8.24e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 607-760
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-27
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 9 Region: 1825-1972
Classification Level Classification E-value
Superfamily Spectrin repeat 3.91e-26
Family Spectrin repeat 0.00072
Further Details:      
 
Domain Number 10 Region: 3212-3354
Classification Level Classification E-value
Superfamily Spectrin repeat 7.68e-26
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 11 Region: 3798-3908
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-25
Family Pleckstrin-homology domain (PH domain) 0.00047
Further Details:      
 
Domain Number 12 Region: 3412-3565
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-25
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 13 Region: 1080-1234
Classification Level Classification E-value
Superfamily Spectrin repeat 1.34e-24
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 14 Region: 2030-2185
Classification Level Classification E-value
Superfamily Spectrin repeat 1.64e-23
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 15 Region: 2778-2916
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-22
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 16 Region: 1400-1517
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-22
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 17 Region: 1521-1651
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-21
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 18 Region: 2513-2617
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-20
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 19 Region: 2406-2509
Classification Level Classification E-value
Superfamily Spectrin repeat 1.73e-17
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 20 Region: 1308-1445
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-17
Family Spectrin repeat 0.00054
Further Details:      
 
Domain Number 21 Region: 991-1097
Classification Level Classification E-value
Superfamily Spectrin repeat 7.29e-16
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 22 Region: 2693-2792
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000106
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 23 Region: 1240-1341
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000475
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 24 Region: 2621-2724
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000912
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 25 Region: 864-940
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000101
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 26 Region: 458-547
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000106
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 27 Region: 3571-3668
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000389
Family Spectrin repeat 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0289294
Sequence length 4337
Comment (Drosophila melanogaster)
Sequence
MEYNSVLRSNFSRNEYRRYISYERQSLASQYEPGGYSALQTPTPSNRNSANMTQRDGIIK
FENERIKTLQEERLHIQKKTFTKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEK
LGKPNSGRMRVHKIENVNKSLAFLHTKVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQ
EIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRP
DLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYH
TFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLE
GIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKA
WQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRYLRQVD
ATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLE
NQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVN
TYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHH
FMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGK
RLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNE
KIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSA
AEPELPEVEQEEWVNETRLVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEGQGMKM
DKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKK
TILVRQVVPVKRIKPVSVAPKPLVQRRTSTQSINENADSVEKRQQRINQTYDELQEMAQK
RHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDEGEGVDNAKRKFEKFITDLSAASKR
VEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTC
DEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNA
YPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQL
NADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERL
KAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAI
LKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFER
KRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANE
GQLRNVTKDGQALVQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRS
LEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAH
GGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPA
AKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQ
QLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAA
KLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLAS
QRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVE
VGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHR
FHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVR
LQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNL
RAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEE
KCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVE
DVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKD
LCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQ
AFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLE
EAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVK
HINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDV
DDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKK
YPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKK
MNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYL
LVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAV
ERLLKKHDEFEKLLHADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEE
RKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSN
SPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFN
RSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQF
FQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQ
LVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYK
SELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVS
VQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRL
AKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSN
LNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQV
HVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAE
AAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWI
NEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHE
VEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGD
SIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQLFRHQLEQEKISKLQEKERLEKE
RLEQLKQRELQRLADERRRAEKQHEHRQNAASQEKTPIFSSPMVTPAQTSGPQSPALSQV
QLRPPFGDDNEHLALQKSSSSGMFGDRLRRGSADANVKRAESMKVQPKQAKRTPSFTTRR
RAQSFRKNQKGEGFDLPPVEIQGSLERKHGLQSGGKKAPVRSWKQFHTVLCGQLVCFFKD
ENDFLQQKTATAPVNILGAKCERADDYTKKKYVFRLKLPDGSEFLFEAPSLDILNDWVRK
ISFHASLPPNMQLLSYDESMKQQSSSSPDIKVTSSVESPVSSRNSSPDSQRRTSGAQVLD
GTATPQMAFLQRQMQQQQQQQQSQPSSPTGGFDQKPPIPPRGAAPVASHRQSQENLVVMR
NRQSSNDLQQSATLPAGLTGVQQNGNGKDDNALLTRNSEARQSDNPPPLPTTMPPVGGQH
QHPQNSHSHQNQHQAQVQQRINAFNAAASQQHQPDYFNNNTARQQPQRIPSGRIDSTRKF
IEMEAHNNNGGTSSSPKRSTINYSSSGASSNGNGNVKIGSGNSSTTTITTSTTTHQVTSS
SRTVWHLTSSPTSSTKSSSTGGSGEPSHAISNPSYMGLHLNNNNDSIGIGLGGWGNTRFE
SNRPVSLQPDSISFSRVSAESSSESEAQSISSVSGVKGSKGTKEERRSGMFRIFGRKGDK
EKEKDKDKRRSSQVPPQ
Download sequence
Identical sequences A8JNJ6
7227.FBpp0289294 NP_001097492.2.81976 FBpp0072934 FBpp0289294 FBpp0289294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]