SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7227.FBpp0289830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7227.FBpp0289830
Domain Number 1 Region: 1526-1664
Classification Level Classification E-value
Superfamily PRC-barrel domain 7.61e-60
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0000129
Further Details:      
 
Domain Number 2 Region: 155-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000569
Family Calponin-homology domain, CH-domain 0.008
Further Details:      
 
Weak hits

Sequence:  7227.FBpp0289830
Domain Number - Region: 358-397
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000154
Family beta-sandwich domain of Sec23/24 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7227.FBpp0289830
Sequence length 1671
Comment (Drosophila melanogaster)
Sequence
MDVETQEIRQARQRASVKWLLSKAFNNRVPDNLKEPFYRDHENQERLKPQIIVELGNATL
YCQTLANLYSDPNYQSMNHWSIIQTLARKGVPVAESADMPITETVLIQTNPLRINAHMSV
IESLMVLYAKEISSGDRVMAAIRRISGNNYQAPTGQSYEQALLGWISHACAALKKRIIKE
VDAGLPDDNGSRLQTPDIPPVRDFQDLCDGICLALLISYYCPKVVPWTSVRINYLPAVED
SIHNILLVCNFSQKHLPYTVMHMTPEDVTYMRGSMKLNLVVLLTDLFNLFEIHPAKCVCY
PGMDGQVPHSNSFGGGLNRRSTPPNEYQTVQSNNFDGNHAEAFVVHKSRGITTLASMHSQ
QQQQLHQQQQHQQQYHQQPLQQHPSQSQLQIQQQEPLVPARLRQAKEKTNVESKADERGD
FVAAGRPSNWEQSRRPSFAGRRSRRNSSSEDSQLTIENFGGSQDQLNTLGRYERDRERKL
SNTSVGSYPVEPAVAVRSSIADARGTLQLGYDTDSGSEKQDRETEKYSMRRQVSVDNVPT
VSSHNLSNAGSPLPVARHKQHSSDKDYSSNSGMTPDAYNDSRSTSGYDPESTPVRKSSTS
SMPASPAAWQLDVGDDDMRSLENASKLSTIRMKLEEKRRRIEQDKRKIEMALLRHQEKED
LESCPDVMKWETMSNESKRTPDMDPVDLDKYQQSIAIMNMNLQDIQQDIHRLATQQSQMQ
AQHLQAQQLMQAQQIANMLNQQQTYGSQQHLADHHYQQQRPMQQSFGSSPHLPQAYNAPV
SAYSSRPPSRDPYQQQLHHQQQQPMPMPQPMQYVNEHGQYMSPPQPAHYMPQQAQQPQSI
YSDNGAAYNHSNHSPYGGTPQYRSSVVYDDYGQPTNHFYLHESSPQPQAHQHPQRRTWAH
SAAAAAYEQQQQIQPSLVDVNAWQTQQHQKQKQTWMNRPPSSAGAPSPGSFMLHQNGGGG
GGGGGGGELQHLFQVQASPQHGQRQVSGSNGVQRQQSLTNLRDNRSPKAPQNMGMPMGMP
MQQEDMMAPQSICFIGDEEDVDELERNIIESMQSTHISDFVHQQQQQHQHQQQLQQQQRL
QGHSGRGSSSEDYDSGEMISNKLNITSGNLTYRIPSPSRPSIQANSFQDPRAMAAASGGE
DQPPEKGFYISFDDEQPKRPKPPLRAKRSPKKESPPGSRDSVDNQATLKRESLSHLHNNN
NIGFGNDDVNSKPVTRHSIHGLNNSNSVKSPGNATYNKYTDEPPIQLRQLAVSGAMSPTS
NERHHLDDVSNQSPQQTQQPMSPTRLQQSSNNAEAAKNKALVIGADSTNLDPESVDEMER
RKEKIMLLSLQRRQQQEEAKARKEIEASQKREKEREKEEERARKKEEQMARRAAILEQHR
LKKAIEEAEREGKTLDRPDLHVKLQSHSSTSTTPRLRQQRTTRPRPKTIHVDDASVDISE
ASSISSRGKKGSSSNLTGYGQLSSNSMKRDYYRGSQDSLTVKESPDDYPSTSSTPIGRRG
SYKTSRDSGLGRATPPRRAPSPGMGMGASGPKLYKQPAAKSNRGIILNAVEYCVFPGVVN
REAKQKVLEKIARSEAKHFLVLFRDAGCQFRALYSYQPETDQVTKLYGTGPSQVEEVMFD
KFFKYNSGGKCFSQVHTKHLTVTIDAFTIHNSLWQGKRVQLPSKKDMALVI
Download sequence
Identical sequences E1JH90
FBpp0289830 7227.FBpp0289830 FBpp0289830 FBpp0289830 NP_001163175.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]