SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0273448 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0273448
Domain Number 1 Region: 11-108
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.56e-17
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0273448
Sequence length 261
Comment (Drosophila pseudoobscura)
Sequence
MPGTHGHPTNPKILLKWINIMLRSDYRSMSELNNGAAWCRLFYCIYPDSFNVEAVVDVGP
PAVLQRNYDILMRTLNRLGIPRQFCVQKLMKGNTTDTIELVHFFMDLYVHKKLAQNRQRP
QPQLQRGPLKEFLGWLKRLIVGTSMEDDPEAYLLLFEEMNDPKPQRRSQPTQTLSPEMNH
RLSGGQKKEPAQQPQQQQQQQQQQPEDLQGHSDQRRKDHDEIRPLIDACHQMLQFQNDME
ERWLEYRRARLARQKTNQRLH
Download sequence
Identical sequences B5DL58
7237.FBpp0273448 FBpp0273448 XP_002133630.1.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]