SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0279476 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0279476
Domain Number 1 Region: 9-127
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-25
Family Calponin-homology domain, CH-domain 0.0000983
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0279476
Sequence length 218
Comment (Drosophila pseudoobscura)
Sequence
MRLRELNVSLTNGNGSTMSRSALMGWVSCMLKVKYTEVGEMVTGVPYCQMMAHMFPGCID
MRRLKVSQYLDSDECIHNLVLLQDAFRRLGIDKAVPIESIARNSFKASLEFLQWFKKFYD
KSYSIEWEDPMGGQILRGHSYSKDGHKPLQSDLRLLCNGDATAIATQAAASVSGSGFPKP
LAKTPLRCWHHQNIFTRHSPNVENAIKMVQQPMDVGRH
Download sequence
Identical sequences FBpp0279476 7237.FBpp0279476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]