SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0280160 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0280160
Domain Number 1 Region: 216-417
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.03e-50
Family DBL homology domain (DH-domain) 0.0000122
Further Details:      
 
Domain Number 2 Region: 24-194
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.64e-29
Family Calponin-homology domain, CH-domain 0.0026
Further Details:      
 
Domain Number 3 Region: 407-581
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-24
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 4 Region: 619-730
Classification Level Classification E-value
Superfamily SH2 domain 1.09e-19
Family SH2 domain 0.0011
Further Details:      
 
Domain Number 5 Region: 725-791
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000144
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0280160
Sequence length 795
Comment (Drosophila pseudoobscura)
Sequence
MASNNNNSSFGSSLGGGIAAVNADLWRECVAWLTRCKIIPPDHKAALPDAEIRILAMTLR
DGVLLCNLVIHLDPSSMDPREFNRKPQMAQFLCSKNIKLFLDVCHNNFGIRDADLFEPTM
LYDLTNFHRVLITLSKLSQCRKVQQLHPDLVGFNLLLSPSERSHSDEAIYKDLHSTTTDN
IACNGTGYDHTNTKEEEVYQDLCALHRTSRSQTASSTSFEQRDYVIRELIDTESNYLDVL
NALKLKFMGPLERHLNQDELRLIFPRIRELADIHTRFLDRLREALSPNTKLRMAQVFMDF
REPFLIYGEYCSCLLGAIDYLADVCKKNQIIDQLVQKCEREYNVGKLQLRDILSVPMQRI
LKYHLLLDKLVKETAPQHEDYRSLERAKEAMIDVSQYINEVKRDSDHLVIIQKVKDSIFD
LHLLQNGNDLLQYGRLLLDGELHIKAHEDQKTKLRYAFVFDKILIMVKSLHIKTGDMQYT
YRDSHNLADYRVEQSHSRRTLGRDTRFKYQLLLARKSGKTAFTLYLKSEHERDKWRKALT
EAMESLDPPGCRNTDHKMEIFTFDTPTSCRHCSKFLKGRIHQGYRCKVCLIAVHKGCISS
TGRCKQNPITQPPPVCDRQLTEFNWFVGNMDRETAANRLENRRIGTYLLRVRPQGPSTAH
ETMYALSLKTDDHVIKHMKINQEIGTEGMLYCLSTRRHFKTIVELVSYYERNDLGENFAG
LNTLLQWPYREVIATALYDYEPKPGSNQLQLRTDCQILVIGKDGDSKGWWRGKIGDTVGY
FPKEYVQEHSPNDEL
Download sequence
Identical sequences Q29GP1
FBpp0280160 7237.FBpp0280160 XP_001355012.2.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]