SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0281126 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0281126
Domain Number 1 Region: 3-155
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-39
Family Calponin-homology domain, CH-domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0281126
Sequence length 169
Comment (Drosophila pseudoobscura)
Sequence
MAPRNKEQEQEVLNWVFAVLGEKVPSGQYEDILKDGIWLCKLANKLAPGSVKKIQERGTN
FQLMENIQRFQAAVKKYGVPEEEIFQTADLFERRNIPQVTLSLYALGRITQKHPEFTGPT
LGPKMSDKNERVFTEEQLRAHEGELNLQMGFNKGASQSGHGGFGNARHM
Download sequence
Identical sequences Q294F0
7237.FBpp0281126 XP_001359862.2.19638 FBpp0281126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]