SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0282667 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0282667
Domain Number 1 Region: 97-396
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.1e-79
Family Calponin-homology domain, CH-domain 0.0000842
Further Details:      
 
Domain Number 2 Region: 1065-1179
Classification Level Classification E-value
Superfamily E set domains 1.15e-34
Family Filamin repeat (rod domain) 0.0000275
Further Details:      
 
Domain Number 3 Region: 1261-1374
Classification Level Classification E-value
Superfamily E set domains 1.33e-34
Family Filamin repeat (rod domain) 0.000034
Further Details:      
 
Domain Number 4 Region: 589-706
Classification Level Classification E-value
Superfamily E set domains 2.07e-29
Family Filamin repeat (rod domain) 0.00085
Further Details:      
 
Domain Number 5 Region: 1957-2049
Classification Level Classification E-value
Superfamily E set domains 7.34e-27
Family Filamin repeat (rod domain) 0.0000695
Further Details:      
 
Domain Number 6 Region: 2152-2242
Classification Level Classification E-value
Superfamily E set domains 6.54e-26
Family Filamin repeat (rod domain) 0.0000475
Further Details:      
 
Domain Number 7 Region: 1777-1866
Classification Level Classification E-value
Superfamily E set domains 9.34e-25
Family Filamin repeat (rod domain) 0.0000561
Further Details:      
 
Domain Number 8 Region: 411-508
Classification Level Classification E-value
Superfamily E set domains 1.4e-24
Family Filamin repeat (rod domain) 0.0005
Further Details:      
 
Domain Number 9 Region: 1453-1569
Classification Level Classification E-value
Superfamily E set domains 1.53e-24
Family Filamin repeat (rod domain) 0.00033
Further Details:      
 
Domain Number 10 Region: 2339-2428
Classification Level Classification E-value
Superfamily E set domains 6.67e-24
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 11 Region: 511-622
Classification Level Classification E-value
Superfamily E set domains 1.07e-23
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 12 Region: 1168-1282
Classification Level Classification E-value
Superfamily E set domains 6.27e-22
Family Filamin repeat (rod domain) 0.00062
Further Details:      
 
Domain Number 13 Region: 709-799
Classification Level Classification E-value
Superfamily E set domains 8.01e-22
Family Filamin repeat (rod domain) 0.00019
Further Details:      
 
Domain Number 14 Region: 876-982
Classification Level Classification E-value
Superfamily E set domains 8.67e-22
Family Filamin repeat (rod domain) 0.00054
Further Details:      
 
Domain Number 15 Region: 1363-1473
Classification Level Classification E-value
Superfamily E set domains 3.07e-21
Family Filamin repeat (rod domain) 0.00094
Further Details:      
 
Domain Number 16 Region: 800-893
Classification Level Classification E-value
Superfamily E set domains 7.34e-21
Family Filamin repeat (rod domain) 0.0009
Further Details:      
 
Domain Number 17 Region: 2468-2558
Classification Level Classification E-value
Superfamily E set domains 2.07e-20
Family Filamin repeat (rod domain) 0.0000592
Further Details:      
 
Domain Number 18 Region: 2244-2336
Classification Level Classification E-value
Superfamily E set domains 5.74e-19
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 19 Region: 2069-2146
Classification Level Classification E-value
Superfamily E set domains 1.73e-18
Family Filamin repeat (rod domain) 0.0002
Further Details:      
 
Domain Number 20 Region: 1708-1788
Classification Level Classification E-value
Superfamily E set domains 3.8e-17
Family Filamin repeat (rod domain) 0.00091
Further Details:      
 
Domain Number 21 Region: 1854-1953
Classification Level Classification E-value
Superfamily E set domains 2.07e-16
Family Filamin repeat (rod domain) 0.0000737
Further Details:      
 
Domain Number 22 Region: 1548-1663
Classification Level Classification E-value
Superfamily E set domains 8.01e-16
Family Filamin repeat (rod domain) 0.00081
Further Details:      
 
Domain Number 23 Region: 986-1085
Classification Level Classification E-value
Superfamily E set domains 9.81e-16
Family Filamin repeat (rod domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0282667
Sequence length 2558
Comment (Drosophila pseudoobscura)
Sequence
MYNGEIERRENAGARETPSAIVASKAFSTRNSNDADDGPVPVPISVHANYTNGGQTAATQ
ATIFLSHSNNSHHLNNRKNPPNFQTNACVNGSGNGNNHTEQNASQFVPNFSNLNFYAQQP
TSAQNNNNNNYDVCHQQPNDYYQQQQQPADQYEENFDEDMEAERDLAEDAQWKKIQQNTF
TRWANEHLKTIDRSINNLETDLSDGLRLIALLEVLSQKRLPKYNKRPTFRSQKLENVSVA
LKFLQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDEKQLNGSGPTP
KQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWEMWDSKDAVQNASEA
MGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYG
PGIEPIGPVVGAPANFTVETFSAGKGAVDVDIEGPNGEIEKADVRFNNDKNLTYTVSYIP
KAEGPHKVTVQFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPTGVTIKKPTFFDILA
KDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSINVFYAGTAIPNS
PFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIHTEGAGEGVPEVRVIGPGGMNQN
VMQSKVDGNTYDCHYYPTKEGRYVIMVTFAGQEVPKSPFEVKVGPKKESSIVAYGPGLSS
GVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILC
DNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTISQPTSFDVDTSKAGNAPLDVV
VQDVYGTKLPVQLASNPDGSKKATYTPISGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAA
KVQAFGPWLQPGVRPNVPTHFNVDAREAGEAELKVKIIHEETKIEVPCRIIDNEDSTYSV
EVMPPAKGAYTTTMTYGGQRVPLGQKVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIITH
GLPKADLAVTITSPSGNRVKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRL
QCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGD
GTCNVAYLPTESGDYTVNITFNDRHINGSPFQPMIVPVPNLKNTRVSGIGIQPHGVIMNA
ATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIE
LMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAI
EGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVK
VYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNSIYAVHY
VPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEATKVKVKGVNEKKKTPASLPAEFEID
TKQAGQADINVAIKNPKGKPMQPRLEEVATGTYVVSFVPDECGTYQCSIKYGDKEIEGSP
FKLEAFPTGEAKKCKLVEQAPKIQPSGSQSHLKVDAREAGNGAVTCKITNKEGSEIVGID
VVEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEEYSHSEYIEEHTTKV
VQKTTQSELVNGKSETSYRSVAFEKLPLPTTGGNVTAEVKMPSGKVDKPVIQDNRDGTVS
VKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGITGEPANFTIS
TKGASAGGLTMAVEGPSKAVINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDRHIKGSPYF
AKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIG
ISFTPRETGEHLVSVKRLGKHISNSPFKVTVCEREVGDAKKVKVSGAGLKEGQTHADNIF
SVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGS
PFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTE
DAEIQEIEDGLYSVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGS
GLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYR
VGLKFNDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGDLDA
RIVAPSGTDDDCFIQAIDSEMTSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKNVAD
PAAVHATGNGLEEVKTGHKADFIINTCNAGVGTLHVSIDGPSKVAMDCTEVEEGYKVRYT
PLLPGEHYITVKYNNVHIVGSPFKVDAVGDKLADEGAQETSTVILETVQKVAKGGKNTGV
HLPNFKSDASKVVPKGMGLNRAYIGKQNQFSICATDAGNNILYVGMYGPKGPCEEFHVKH
AGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV
Download sequence
Identical sequences B5DYT7
FBpp0282667 7237.FBpp0282667 XP_002137089.1.19638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]