SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0284159 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0284159
Domain Number 1 Region: 126-616
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.85e-161
Family Calponin-homology domain, CH-domain 0.00000000353
Further Details:      
 
Domain Number 2 Region: 6-93,415-447
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000055
Family Calmodulin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0284159
Sequence length 645
Comment (Drosophila pseudoobscura)
Sequence
MATLNKFTKTLSIDEKTEIKEKFTELDANKDGFIDLHELKDALNQVGFKLAGYQVREMID
EFKSKQRTAHQGKLNLEEFETLCLDLKSKDVASTFKTVVSKKENLETLGGMSSSSSEGTT
HSVRLEEQLAFSDWINSNLGHDKDLQHLLPIDSEGKRLYLSIKDGILLCKIINHSCPDTI
DERAINKKNLTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIG
LFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGIRRRCTNFQSDIV
DSEIYSHLLKQIAGNDADVNLDALREADLQSRAEIMLQQAGKLNCRSFLTPQDVVNGVYK
LNLAFVANLFNNHPGLDKPEQIEGLESIEETREEKTYRNWMNSMGVSPHVNWLYSDLADG
LVIFQLFDVIKPGIVNWSRVHKRFTPLRKFMEKLENCNYAVDLGKQLKFSLVGIAGQDLN
DGNATLTLALIWQLMRAYTLSILSRLANTGNPIIEKEIVQWVNNRLTEAGKQSQLRNFND
HAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALPEDI
TEVKPKMVMTVFACMMALDYVPNMDSVDQNNHNNSTPVVATNNSN
Download sequence
Identical sequences Q29HT6
XP_001354617.1.19638 7237.FBpp0284159 FBpp0284159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]