SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0284949 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7237.FBpp0284949
Domain Number 1 Region: 7-227
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.6e-62
Family Calponin-homology domain, CH-domain 0.0000432
Further Details:      
 
Domain Number 2 Region: 381-518
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000734
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 1130-1265
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000103
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 4 Region: 1218-1359
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000082
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 5 Region: 304-410
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000489
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number 6 Region: 1374-1474
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000705
Family Spectrin repeat 0.012
Further Details:      
 
Weak hits

Sequence:  7237.FBpp0284949
Domain Number - Region: 490-610
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000158
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 999-1115
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000355
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 2221-2286
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000489
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number - Region: 2070-2140
Classification Level Classification E-value
Superfamily LemA-like 0.0458
Family LemA-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0284949
Sequence length 2310
Comment (Drosophila pseudoobscura)
Sequence
MEPGILIDERQHIQKKTFTKWINSHLSDTQCTPVKDLFIDLRDGHRLLALLSNLTQTQMK
PEKGRMRVHHINNLNKVIHVIQQHGVKLVNISSDDIVGGNPKLTLGLIWLIALEFNGQHL
VKSHSSNGVEKSLLAWARQYTKPQGLQLTDFSSSWADGRAFLMILAAHLGELHLEAALQQ
HALQRLHLAFDLAHRHFKIEKLLDAEDVHTHKPDNKSIQMYAMCLYHAMESMRAAQREQQ
EQQAEQDRVPCTSITDLDEVPLDTMEIYTSESGGSLEKGSTVELKSSMRPLSTATNASVE
ISGYQTALEAVLTLLLEDEQLLSQEIPDQQDFQRAKFQFHENESFMLKLTEHQEYVGEAL
EEGSNLINESQKAGGAGLSLEDQNEVRQQMVLLNERWETLRLRALDVQAKILMRLAEFQK
QKLEQLRQFLTNVEDRISHMSDIGPTLPEAEKQLVEARSLKSDLSEQQELVDSLSSMVVI
VNDTSGNFIDLEDRLSALGERWSHVVKWSDLRTEKLQQYKCISRWLDAREQDLKQMECQD
VTDVGGITQRINELNYCAKDLLELQRYLIDLRQMVAATLQDGDDRGERVLVQLESYEDRL
DALKQILEVQTVRIETKGFNFGRDRASYDDSRVVRPEGWVDYQMIIRFGEELDEESELSH
DSATKKRKLRNGENFYALEMQIMEHFSYVQEAEAKLQQLQRQSLRQQCDVLKELQAENHL
KSATLPELKKLYEVCELEDPSRNLVLEDTHIKQLEQRYGLLTQRLATQQSESQTLFAKER
YYNSLTGFKLVLADSRDWYKQHAGTASGEELEQRLSHMESLSLEIAEAKKATEELDVSLV
EWKQDFGLFYDSWHDMKQALQALIQQRGGENLSREMEEIKGFMDKVGSQKVRVSSLEIMQ
HQQQSLNHLVDELENLKTKYERLPRSLLSEDLQATWQRLPEMLNERVIKQTTAIENLNHF
TAEYNAIIAVLQTAADGKSGSGTSQDLRKLEIDVISARNFSEILIKEAEPQQKDFLQSQI
RTLNALYEKVEQVHREQRQQQLEIHTQMDVVQQRLRKTDQWLSELEKNTPKSGVADIPNS
NELFQSKCRFQTLKESCEKETTSFRDLNELGGDLLVQMDELQDKEKESKYGSLAKQFTRL
NARWTEVTETVYAKTALLEHISTQLGEFKKFMVSETGYLDRLENKIRNTPENAADAEEIM
EELDDLENVLRSHSDEWLEKIQEIGTELIDNEFMAETMRKDIQDMVDRWNVLQQQAKKRT
ELLEEKVSEAEQSEKCIVQFEAWLTRVDEILSEHLENDVTIEDLPDDFQRLAREFITNEQ
NFKEITELIAEHTRNGKMGAANRLQEQLNLMELRFKACQAKLSKCTAPQPAYESRLNRAY
GDLRNVERSTLVLDVASAGPNTVQAQYQKCLQIYRTLSEIKAEIESTIKTGRRVCEDRYT
KSPKLLSQKIDALKHLYNALGENVTQSKVFLEGLLSLARNLEECFDSADTLIRRFESPQE
VHDRNSILLDFEEVLRKCEEHYNEYSKSCDQSCMVDTRQRIDGLKATYHKLTSADIIKRL
TEMKATLQNLDNISLETLKAMEHDLKEINVPSNPEIEKLQQQVIAIVVDVLKTRFNEATT
LNTNSTQKSPNDDDTEIVVVSDTVRQRRARTPQAGESPSTKSPTESPTKSVETPSEASGE
QVLPDVLPPQTFRLAESSTLFSQISLNPANVSQSSPPPKPNKTKRKAPAIPAQMVEIRVK
NIQNDKMSVQSIHHGSGSGAMEPHQGEIVSTVNILESVEPFVPEYVETVQIVDLSEDSDS
SSLTKSKHSLCESPLPTVVDDEETLLRPGDGNTSTPFLRVEKHRISFDEKRKRIANERDI
LRDSEEDEDGPKTPDAPRAPQVSKPKRWRHLQPGTPDTEPESPGRDSFYSPDKESGFDIE
PLVFSDDEEIPRFSLEMTPTIDSDSDTSRIETPSAKKPASFLSKVLHSMPSPADDSNVTL
KSPLGAQEPKSLDDRVREFDKQAKQMIYKLKLTKAKIEQCHESEAEDLRLLIAPDAATLI
SQGDSLVLETHGRQGSISRLVMRTQIILREQFREVQQARSKTMGSGAAAPPLESVNIEEL
VTKGLRRINVLIEKPVDLKSSGDLEKRMDDINERHDDLQVIVGAIGKNAQMPKVTPLMMN
EIEKTKNNLIAHADAIELSLTELRNGNRISNGKESDQRVPPIAQRSEYNNEPSGSGALAG
SFDKSVLQISDWLTWEQNMIKIQSVLVEDVDAIRMAIEKQEKVLRELKMKKPQLNELVHT
AEVLKGDMKRQQLQEKGKEIYMQNTNGKAA
Download sequence
Identical sequences FBpp0284949 7237.FBpp0284949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]