SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7237.FBpp0285582 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7237.FBpp0285582
Domain Number - Region: 37-83
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00628
Family Mitotic arrest deficient-like 1, Mad1 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7237.FBpp0285582
Sequence length 84
Comment (Drosophila pseudoobscura)
Sequence
MFAKQAELITANTLKSEGVLQAIEEKFTAMTNQILGMAVDVKKLTERVLHLEKAGEVIHE
MEQQIIKLKNEVHGMPEYVRKLQI
Download sequence
Identical sequences 7237.FBpp0285582 FBpp0285582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]